Result : Q9KA12
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0109 protein BH2482 |
| NCBI Accession ID | BA000004.3 |
| Organism | Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
| Left | 2600551 |
| Right | 2600781 |
| Strand | - |
| Nucleotide Sequence | ATGAAAACGTTAGTAGAACATATCGCAATGGCGCTTGTGGATCATCCTGATGATGTTCGTGTTTCTGAGCACGATGATGGCCATTCTTTGCACATCGAGCTATCGGTTCATCCGGATGATATGGGAAAAGTAATAGGGAAGCAAGGTCGCACAGCGAAGGCGTTACGTTCTGTCGTCTATGCAGCAGCGACAAAGCAAAAGAGGCGAGTTCGGTTAGACATCATCGATTAA |
| Sequence | MKTLVEHIAMALVDHPDDVRVSEHDDGHSLHIELSVHPDDMGKVIGKQGRTAKALRSVVYAAATKQKRRVRLDIID |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00098. Profile Description: K homology (KH) RNA-binding domain, type I. Rrp40, also called exosome component 3 (EXOSC3), or ribosomal RNA-processing protein 40, is a non-catalytic component of the RNA exosome complex which has 3'-->5' exoribonuclease activity and participates in a multitude of cellular RNA processing and degradation events. Mutations of EXOSC3 gene are associated with neurological diseases. Members in this subfamily contain a divergent KH domain that lacks the RNA-binding GXXG motif. |
| Pubmed ID | 11058132 |
| Domain | CDD:412160 |
| Functional Category | RNA-binding |
| Uniprot ID | Q9KA12 |
| ORF Length (Amino Acid) | 76 |
++ More..
| Conservation Analysis |
No. of Species: 330
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2600551 | 2600781 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 2 | 2340938 | 2341168 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 3 | 2722852 | 2723079 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 4 | 3401680 | 3401907 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 5 | 1987748 | 1987975 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 6 | 2599937 | 2600164 | + | NZ_CP026363.1 | Brevibacillus agri |
| 7 | 2388553 | 2388780 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 8 | 6385927 | 6386157 | - | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 9 | 1241009 | 1241239 | + | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 10 | 2378771 | 2378998 | - | NZ_CP020559.1 | Clostridium formicaceticum |
| 11 | 552190 | 552417 | + | NZ_CP016379.1 | Anoxybacter fermentans |
| 12 | 2009451 | 2009681 | + | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 13 | 4322761 | 4322994 | - | NZ_AP019400.1 | Cohnella abietis |
| 14 | 3434477 | 3434704 | + | NZ_CP021434.1 | Tumebacillus avium |
| 15 | 2129425 | 2129652 | - | NZ_CP009687.1 | Clostridium aceticum |
| 16 | 3586201 | 3586431 | + | NZ_CP011388.1 | Paenibacillus swuensis |
| 17 | 1442360 | 1442590 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 18 | 1396684 | 1396911 | + | NZ_CP043998.1 | Clostridium diolis |
| 19 | 1574135 | 1574362 | + | NC_022571.1 | Clostridium saccharobutylicum DSM 13864 |
| 20 | 1047295 | 1047510 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 21 | 1193522 | 1193749 | + | NZ_CP032416.1 | Clostridium fermenticellae |
| 22 | 1186150 | 1186377 | + | NZ_CP020953.1 | Clostridium drakei |
| 23 | 3081830 | 3082057 | - | NZ_CP009933.1 | Clostridium scatologenes |
| 24 | 1905388 | 1905615 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 25 | 147423 | 147650 | + | NZ_CP011803.1 | Clostridium carboxidivorans P7 |
| 26 | 443375 | 443602 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 27 | 821371 | 821598 | - | NZ_CP029256.1 | Christensenella minuta |
| 28 | 4067838 | 4068068 | - | NZ_CP034346.1 | Paenibacillus lutimineralis |
| 29 | 2526999 | 2527226 | - | NZ_CP028842.1 | Clostridium botulinum |
| 30 | 2789485 | 2789712 | - | NZ_CP011663.1 | Clostridium sporogenes |
| 31 | 2165262 | 2165489 | - | NZ_CP048103.1 | Kroppenstedtia eburnea |
| 32 | 2100855 | 2101082 | - | NZ_CP019698.1 | Desulfotomaculum ferrireducens |
| 33 | 2546238 | 2546468 | - | NZ_CP061336.1 | Ruminiclostridium herbifermentans |
| 34 | 822421 | 822651 | + | NC_011898.1 | Ruminiclostridium cellulolyticum H10 |
| 35 | 2496316 | 2496546 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 36 | 1915456 | 1915683 | - | NC_014387.1 | Butyrivibrio proteoclasticus B316 |
| 37 | 1117464 | 1117694 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 38 | 1688385 | 1688612 | - | NZ_CP014204.2 | Clostridium baratii |
| 39 | 1057185 | 1057418 | + | NZ_CP033433.1 | Cohnella candidum |
| 40 | 1219339 | 1219566 | + | NC_013216.1 | Desulfofarcimen acetoxidans DSM 771 |
| 41 | 2262489 | 2262719 | - | NZ_CP007032.1 | Desulfitobacterium metallireducens DSM 15288 |
| 42 | 2319094 | 2319324 | - | NZ_CP014229.1 | Desulfovibrio fairfieldensis |
| 43 | 1442725 | 1442952 | + | NC_011837.1 | Clostridium kluyveri NBRC 12016 |
| 44 | 1659497 | 1659724 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 45 | 1822407 | 1822634 | + | NC_015589.1 | Desulfotomaculum ruminis DSM 2154 |
| 46 | 3988630 | 3988860 | - | NZ_CP034248.1 | Paenibacillus lentus |
| 47 | 1945705 | 1945935 | + | NZ_CP021850.1 | Pseudoclostridium thermosuccinogenes |
| 48 | 1161739 | 1161966 | + | NZ_CP030775.1 | Clostridium butyricum |
| 49 | 3906900 | 3907127 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 50 | 4812860 | 4813090 | - | NZ_CP026520.1 | Paenibacillus chitinolyticus |
| 51 | 1884333 | 1884563 | - | NZ_CP048877.1 | Thermosulfuriphilus ammonigenes |
| 52 | 58802 | 59029 | + | NZ_LR130778.1 | Petrocella atlantisensis |
| 53 | 2931500 | 2931727 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 54 | 1251506 | 1251733 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 55 | 1278815 | 1279054 | + | NZ_CP027286.1 | Clostridium chauvoei |
| 56 | 1221481 | 1221714 | - | NZ_CP027228.1 | Mogibacterium diversum |
| 57 | 1764377 | 1764607 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 58 | 3503724 | 3503954 | + | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 59 | 3625733 | 3625960 | + | NZ_CP012395.1 | Clostridium autoethanogenum DSM 10061 |
| 60 | 1389677 | 1389904 | + | NC_014328.1 | Clostridium ljungdahlii DSM 13528 |
| 61 | 2250539 | 2250766 | - | NC_009253.1 | Desulfotomaculum reducens MI-1 |
| 62 | 2673142 | 2673372 | - | NC_014624.2 | Eubacterium callanderi |
| 63 | 4300000 | 4300230 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 64 | 3103262 | 3103492 | + | NZ_CP019962.1 | Eubacterium limosum |
| 65 | 1554947 | 1555174 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 66 | 1090986 | 1091213 | + | NC_015520.1 | Mahella australiensis 50-1 BON |
| 67 | 2761250 | 2761480 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 68 | 2814115 | 2814345 | + | NZ_CP043611.1 | Paenibacillus antarcticus |
| 69 | 790995 | 791222 | + | NC_011899.1 | Halothermothrix orenii H 168 |
| 70 | 3258498 | 3258725 | - | NZ_CP022464.2 | Enterocloster bolteae |
| 71 | 1305768 | 1305962 | + | NC_015681.1 | Thermodesulfatator indicus DSM 15286 |
| 72 | 1844551 | 1844778 | + | NZ_CP040924.1 | Clostridium thermarum |
| 73 | 873196 | 873426 | + | NC_015388.1 | Desulfobacca acetoxidans DSM 11109 |
| 74 | 1405817 | 1406044 | - | NC_015555.1 | Thermoanaerobacterium xylanolyticum LX-11 |
| 75 | 1482717 | 1482944 | - | NZ_CP047602.1 | Thermoanaerobacterium aotearoense |
| 76 | 2290073 | 2290300 | + | NC_014393.1 | Clostridium cellulovorans 743B |
| 77 | 1028001 | 1028231 | + | NZ_CP014167.1 | Paenibacillus yonginensis |
| 78 | 1545942 | 1546175 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 79 | 1055514 | 1055741 | + | NZ_LT906477.1 | Clostridium cochlearium |
| 80 | 3448847 | 3449077 | - | NZ_CP009286.1 | Paenibacillus stellifer |
| 81 | 301781 | 302011 | - | NZ_CP017269.1 | Geosporobacter ferrireducens |
| 82 | 3683085 | 3683324 | - | NZ_CP071376.1 | Clostridium gasigenes |
| 83 | 2431802 | 2432032 | + | NZ_CP039126.1 | Blautia producta |
| 84 | 2873073 | 2873303 | + | NC_014836.1 | Desulfurispirillum indicum S5 |
| 85 | 1200557 | 1200784 | + | NZ_CP017253.2 | Clostridium taeniosporum |
| 86 | 3238966 | 3239196 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 87 | 3753963 | 3754193 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 88 | 3238907 | 3239137 | - | NC_018017.1 | Desulfitobacterium dehalogenans ATCC 51507 |
| 89 | 2209774 | 2210004 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 90 | 4956675 | 4956905 | - | NZ_CP009285.1 | Paenibacillus borealis |
| 91 | 4177444 | 4177674 | - | NZ_CP009428.1 | Paenibacillus odorifer |
| 92 | 2204548 | 2204775 | - | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 93 | 3290318 | 3290548 | - | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 94 | 1449539 | 1449772 | - | NC_015949.1 | Caldicellulosiruptor lactoaceticus 6A |
| 95 | 1574236 | 1574466 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 96 | 1472409 | 1472636 | - | NC_014410.1 | Thermoanaerobacterium thermosaccharolyticum DSM 571 |
| 97 | 1069199 | 1069429 | + | NZ_CP045293.1 | Paenibacillus guangzhouensis |
| 98 | 6168811 | 6169041 | - | NZ_CP048429.1 | Paenibacillus jilunlii |
| 99 | 6308674 | 6308904 | - | NZ_CP068595.1 | Paenibacillus sonchi |
| 100 | 4767369 | 4767599 | - | NZ_LN831776.1 | Paenibacillus riograndensis SBR5 |
| 101 | 2595055 | 2595285 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 102 | 3160583 | 3160813 | + | NC_006138.1 | Desulfotalea psychrophila LSv54 |
| 103 | 3012137 | 3012367 | + | NZ_CP040098.1 | Desulfoglaeba alkanexedens ALDC |
| 104 | 2789125 | 2789361 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 105 | 3268282 | 3268512 | - | NZ_CP004078.1 | Paenibacillus sabinae T27 |
| 106 | 1457378 | 1457608 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
| 107 | 1713376 | 1713606 | + | NZ_CP016502.1 | Acetivibrio thermocellus DSM 2360 |
| 108 | 1228584 | 1228814 | + | NZ_CP007452.1 | Peptoclostridium acidaminophilum DSM 3953 |
| 109 | 842515 | 842709 | + | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 110 | 4576838 | 4577068 | + | NZ_CP011058.1 | Paenibacillus beijingensis |
| 111 | 2268262 | 2268489 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 112 | 187728 | 187967 | - | NZ_CP023671.1 | Clostridium septicum |
| 113 | 2765464 | 2765694 | + | NZ_CP048209.1 | Paenibacillus lycopersici |
| 114 | 1208494 | 1208724 | + | NZ_LN879430.1 | Herbinix luporum |
| 115 | 2794918 | 2795148 | - | NC_009943.1 | Desulfococcus oleovorans Hxd3 |
| 116 | 2293071 | 2293304 | - | NC_009437.1 | Caldicellulosiruptor saccharolyticus DSM 8903 |
| 117 | 1700180 | 1700410 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 118 | 1759883 | 1760113 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
| 119 | 1276977 | 1277198 | + | NC_014926.1 | Thermovibrio ammonificans HB-1 |
| 120 | 1166504 | 1166743 | - | NZ_CP016786.1 | Clostridium isatidis |
| 121 | 3994926 | 3995156 | - | NC_011830.1 | Desulfitobacterium hafniense DCB-2 |
| 122 | 959655 | 959885 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 123 | 2128590 | 2128820 | - | NZ_LR699011.1 | Roseburia hominis |
| 124 | 410300 | 410533 | - | NZ_AP013035.1 | Thermosulfidibacter takaii ABI70S6 |
| 125 | 799524 | 799754 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 126 | 861253 | 861486 | + | NC_014657.1 | Caldicellulosiruptor owensensis OL |
| 127 | 1652759 | 1652992 | - | NC_014392.1 | Caldicellulosiruptor obsidiansis OB47 |
| 128 | 1786134 | 1786367 | - | NC_014652.1 | Caldicellulosiruptor hydrothermalis 108 |
| 129 | 1023113 | 1023346 | + | NC_014721.1 | Caldicellulosiruptor kristjanssonii I77R1B |
| 130 | 1872142 | 1872375 | - | NC_014720.1 | Caldicellulosiruptor kronotskyensis 2002 |
| 131 | 1121217 | 1121450 | + | NZ_CP034791.1 | Caldicellulosiruptor changbaiensis |
| 132 | 1073264 | 1073497 | + | NC_012034.1 | Caldicellulosiruptor bescii DSM 6725 |
| 133 | 1919212 | 1919439 | + | NZ_CP036259.1 | Sporomusa termitida |
| 134 | 4233004 | 4233234 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 135 | 3786034 | 3786264 | - | NZ_CP009288.1 | Paenibacillus durus |
| 136 | 1706611 | 1706841 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 137 | 897139 | 897369 | - | NZ_CP048286.1 | Paenibacillus rhizovicinus |
| 138 | 3737265 | 3737495 | - | NZ_CP021780.1 | Paenibacillus donghaensis |
| 139 | 1302698 | 1302928 | + | NC_020134.1 | Thermoclostridium stercorarium subsp. stercorarium DSM 8532 |
| 140 | 1262454 | 1262684 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 141 | 3491352 | 3491582 | - | NZ_CP020028.1 | Paenibacillus kribbensis |
| 142 | 4236312 | 4236542 | - | NZ_CP009287.1 | Paenibacillus graminis |
| 143 | 1162418 | 1162651 | - | NZ_CP045798.1 | Thermoanaerosceptrum fracticalcis |
| 144 | 1181035 | 1181265 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 145 | 1486976 | 1487203 | - | NZ_LR590481.1 | Hathewaya histolytica |
| 146 | 1621958 | 1622188 | - | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 147 | 2746780 | 2747010 | - | NC_014972.1 | Desulfobulbus propionicus DSM 2032 |
| 148 | 1536313 | 1536540 | - | NC_014654.1 | Halanaerobium hydrogeniformans |
| 149 | 436424 | 436654 | + | NC_018025.1 | Desulfomonile tiedjei DSM 6799 |
| 150 | 5465258 | 5465488 | + | NZ_CP016809.1 | Paenibacillus ihbetae |
| 151 | 1879049 | 1879279 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 152 | 4233433 | 4233660 | - | NZ_AP018449.1 | Methylomusa anaerophila |
| 153 | 2456592 | 2456822 | - | NZ_AP019308.1 | Paenibacillus baekrokdamisoli |
| 154 | 1951478 | 1951705 | + | NZ_CP045875.1 | Heliorestis convoluta |
| 155 | 3932517 | 3932747 | + | NC_018645.1 | Desulfobacula toluolica Tol2 |
| 156 | 3519208 | 3519438 | - | NC_012108.1 | Desulfobacterium autotrophicum HRM2 |
| 157 | 2567324 | 2567554 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 158 | 4219935 | 4220165 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 159 | 2825922 | 2826152 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 160 | 1562005 | 1562235 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 161 | 4250658 | 4250888 | - | NZ_AP021876.1 | Desulfosarcina ovata subsp. sediminis |
| 162 | 387344 | 387538 | - | NZ_CP042909.1 | Thermosulfurimonas marina |
| 163 | 6150635 | 6150865 | + | NZ_CP045295.1 | Paenibacillus cellulositrophicus |
| 164 | 2603824 | 2604054 | + | NZ_CP013023.1 | Paenibacillus bovis |
| 165 | 1562345 | 1562572 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 166 | 4965418 | 4965648 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 167 | 931368 | 931562 | - | NC_017310.1 | Desulfovibrio vulgaris RCH1 |
| 168 | 323221 | 323451 | + | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 169 | 1794882 | 1795109 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 170 | 2301159 | 2301389 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 171 | 2371706 | 2371936 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 172 | 2012402 | 2012629 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 173 | 3301306 | 3301536 | + | NZ_CP034437.1 | Paenibacillus albus |
| 174 | 3397664 | 3397894 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 175 | 2287595 | 2287792 | - | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 176 | 5757006 | 5757236 | - | NC_011768.1 | Desulfatibacillum aliphaticivorans |
| 177 | 2686654 | 2686884 | - | NC_019903.1 | Desulfitobacterium dichloroeliminans LMG P-21439 |
| 178 | 6105642 | 6105872 | + | NZ_CP054614.1 | Paenibacillus barcinonensis |
| 179 | 2092796 | 2093023 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 180 | 2343074 | 2343304 | - | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 181 | 3840448 | 3840678 | + | NC_016641.1 | Paenibacillus terrae HPL-003 |
| 182 | 1601848 | 1602075 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 183 | 3702373 | 3702603 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 184 | 3747125 | 3747355 | + | NC_008554.1 | Syntrophobacter fumaroxidans MPOB |
| 185 | 705886 | 706080 | + | NC_015682.1 | Thermodesulfobacterium geofontis OPF15 |
| 186 | 1467429 | 1467662 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 187 | 4370606 | 4370836 | + | NZ_CP045298.1 | Paenibacillus brasilensis |
| 188 | 1802814 | 1803050 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 189 | 1307487 | 1307714 | - | NC_014964.1 | Thermoanaerobacter brockii subsp. finnii Ako-1 |
| 190 | 1419012 | 1419239 | - | NC_015958.1 | Thermoanaerobacter wiegelii Rt8.B1 |
| 191 | 2208088 | 2208318 | - | NZ_CP039543.1 | Desulfovibrio marinus |
| 192 | 1807028 | 1807255 | - | NZ_CP014170.1 | Clostridium tyrobutyricum |
| 193 | 2385279 | 2385512 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 194 | 1061952 | 1062182 | - | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 195 | 1607020 | 1607250 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 196 | 3094413 | 3094646 | - | NZ_CP014176.1 | Clostridium argentinense |
| 197 | 2786125 | 2786352 | - | NC_021184.1 | Desulfoscipio gibsoniae DSM 7213 |
| 198 | 2097037 | 2097270 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 199 | 3505655 | 3505885 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 200 | 1347436 | 1347657 | - | NC_012440.1 | Persephonella marina EX-H1 |
| 201 | 4652988 | 4653218 | + | NZ_CP041217.1 | Saccharibacillus brassicae |
| 202 | 1431836 | 1432072 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 203 | 1403722 | 1403949 | - | NC_008593.1 | Clostridium novyi NT |
| 204 | 1328102 | 1328332 | - | NZ_LT635479.1 | Lachnoclostridium phocaeense |
| 205 | 4043247 | 4043456 | - | NZ_CP045504.1 | Desulfovibrio sulfodismutans DSM 3696 |
| 206 | 3135815 | 3136045 | - | NZ_CP045508.1 | Desulfolutivibrio sulfoxidireducens |
| 207 | 1708526 | 1708753 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 208 | 3073673 | 3073906 | + | NZ_CP042430.1 | Baekduia soli |
| 209 | 1303307 | 1303534 | - | NC_014209.1 | Thermoanaerobacter mathranii subsp. mathranii str. A3 |
| 210 | 1281509 | 1281736 | - | NC_013921.1 | Thermoanaerobacter italicus Ab9 |
| 211 | 2377538 | 2377768 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 212 | 2196388 | 2196618 | - | NC_007759.1 | Syntrophus aciditrophicus SB |
| 213 | 3018702 | 3018935 | + | NZ_CP013661.2 | Planococcus kocurii |
| 214 | 2244878 | 2245111 | - | NZ_CP019401.1 | Planococcus faecalis |
| 215 | 1794629 | 1794823 | + | NZ_CP046400.1 | Pseudodesulfovibrio cashew |
| 216 | 2619695 | 2619889 | + | NZ_LT907975.1 | Pseudodesulfovibrio profundus |
| 217 | 2110753 | 2110986 | - | NZ_CP016540.2 | Planococcus versutus |
| 218 | 2200337 | 2200570 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 219 | 212250 | 212480 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 220 | 2084616 | 2084846 | + | NC_014758.1 | Calditerrivibrio nitroreducens DSM 19672 |
| 221 | 3795994 | 3796224 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 222 | 371099 | 371326 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 223 | 2420828 | 2421055 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 224 | 6131484 | 6131714 | - | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 225 | 5681072 | 5681302 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 226 | 6455311 | 6455541 | + | NZ_AP021874.1 | Desulfosarcina alkanivorans |
| 227 | 1972222 | 1972455 | - | NZ_CP016538.2 | Planococcus maritimus |
| 228 | 1995465 | 1995698 | - | NZ_CP059540.1 | Planococcus maritimus |
| 229 | 1425547 | 1425774 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 230 | 1058165 | 1058395 | + | NZ_CP026538.1 | Desulfovibrio carbinolicus |
| 231 | 3904591 | 3904821 | - | NC_012796.1 | Desulfovibrio magneticus RS-1 |
| 232 | 551042 | 551269 | + | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 233 | 1050647 | 1050877 | + | NZ_LR134483.1 | Listeria grayi |
| 234 | 565653 | 565886 | - | NC_016629.1 | Desulfocurvibacter africanus subsp. africanus str. Walvis Bay |
| 235 | 1019361 | 1019588 | + | NC_017455.1 | Halanaerobium praevalens DSM 2228 |
| 236 | 2090704 | 2090934 | - | NC_015672.1 | Flexistipes sinusarabici DSM 4947 |
| 237 | 2140467 | 2140697 | - | NZ_CP014223.1 | Anaerotignum propionicum DSM 1682 |
| 238 | 1447760 | 1447987 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
| 239 | 679427 | 679657 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 240 | 3885379 | 3885609 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 241 | 618300 | 618500 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 242 | 1581258 | 1581488 | + | NZ_CP011102.1 | Listeria weihenstephanensis |
| 243 | 6750974 | 6751204 | + | NZ_AP021875.1 | Desulfosarcina widdelii |
| 244 | 3741904 | 3742101 | + | NC_013173.1 | Desulfomicrobium baculatum DSM 4028 |
| 245 | 3277036 | 3277269 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 246 | 1949671 | 1949904 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 247 | 3988490 | 3988720 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 248 | 2763319 | 2763555 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 249 | 1438364 | 1438591 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 250 | 3027810 | 3028043 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 251 | 4880561 | 4880791 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 252 | 2700349 | 2700576 | - | NZ_CP019870.1 | Clostridioides difficile |
| 253 | 2184793 | 2185020 | + | NC_010337.2 | Heliomicrobium modesticaldum Ice1 |
| 254 | 2540181 | 2540414 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 255 | 1433348 | 1433575 | - | NC_003869.1 | Caldanaerobacter subterraneus subsp. tengcongensis MB4 |
| 256 | 1214405 | 1214638 | + | NC_017583.1 | Spirochaeta thermophila DSM 6578 |
| 257 | 9200521 | 9200751 | + | NZ_CP012333.1 | Labilithrix luteola |
| 258 | 2962544 | 2962774 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 259 | 1309516 | 1309707 | - | NZ_CP009170.1 | Thermoanaerobacter kivui |
| 260 | 1391632 | 1391865 | + | NC_017098.1 | Spirochaeta africana DSM 8902 |
| 261 | 1145769 | 1145999 | + | NZ_CP046996.1 | Dehalobacter restrictus |
| 262 | 1280082 | 1280312 | - | NZ_CP027002.1 | [Ruminococcus] gnavus ATCC 29149 |
| 263 | 2211401 | 2211628 | - | NZ_CP013019.1 | Clostridium pasteurianum |
| 264 | 1767896 | 1768129 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 265 | 772379 | 772612 | - | NZ_LT635480.1 | Ndongobacter massiliensis |
| 266 | 1788890 | 1789123 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 267 | 1416594 | 1416821 | - | NC_013385.1 | Ammonifex degensii KC4 |
| 268 | 1219353 | 1219589 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 269 | 305211 | 305447 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 270 | 667205 | 667441 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 271 | 1715469 | 1715705 | - | NC_008346.1 | Syntrophomonas wolfei subsp. wolfei str. Goettingen G311 |
| 272 | 1826842 | 1827045 | - | NZ_LT985188.1 | Micropruina glycogenica |
| 273 | 1325653 | 1325880 | + | NZ_CP040058.1 | Anaerostipes rhamnosivorans |
| 274 | 2232709 | 2232936 | - | NZ_CP036345.1 | Anaerostipes caccae L1-92 |
| 275 | 3194332 | 3194568 | - | NZ_CP036250.1 | Egicoccus halophilus |
| 276 | 3001069 | 3001299 | + | NC_016803.1 | Pseudodesulfovibrio mercurii |
| 277 | 2150768 | 2151004 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 278 | 2890367 | 2890594 | - | NZ_CP014150.1 | Paeniclostridium sordellii |
| 279 | 149477 | 149680 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 280 | 1490890 | 1491117 | - | NZ_LR778174.1 | Veillonella parvula |
| 281 | 543800 | 543994 | - | NC_016633.1 | Sphaerochaeta pleomorpha str. Grapes |
| 282 | 1572936 | 1573163 | - | NZ_CP034118.1 | Staphylospora marina |
| 283 | 2618095 | 2618325 | + | NC_010814.1 | Geobacter lovleyi SZ |
| 284 | 675415 | 675642 | + | NZ_LT906470.1 | Veillonella rodentium |
| 285 | 2905550 | 2905777 | - | NZ_CP015756.1 | Clostridium estertheticum subsp. estertheticum |
| 286 | 2159265 | 2159495 | - | NC_016620.1 | Halobacteriovorax marinus SJ |
| 287 | 911979 | 912209 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 288 | 1954446 | 1954673 | - | NZ_CP048104.1 | Kroppenstedtia pulmonis |
| 289 | 2032206 | 2032439 | + | NC_014364.1 | Sediminispirochaeta smaragdinae DSM 11293 |
| 290 | 9948763 | 9948993 | + | NZ_CP035758.1 | Ktedonosporobacter rubrisoli |
| 291 | 1432227 | 1432454 | - | NZ_LR134375.1 | Veillonella dispar |
| 292 | 1379338 | 1379565 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 293 | 5374767 | 5374997 | + | NZ_CP063849.1 | Paludibaculum fermentans |
| 294 | 2066987 | 2067217 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 295 | 2647815 | 2648045 | + | NC_016048.1 | Oscillibacter valericigenes Sjm18-20 |
| 296 | 3165910 | 3166140 | - | NZ_CP036170.1 | [Clostridium] scindens ATCC 35704 |
| 297 | 1731212 | 1731445 | + | NZ_AP014924.1 | Limnochorda pilosa |
| 298 | 1377145 | 1377375 | + | NZ_CP048649.1 | Aminipila butyrica |
| 299 | 1887749 | 1887976 | - | NZ_HG917868.1 | Clostridium bornimense |
| 300 | 2015455 | 2015685 | - | NZ_CP030280.1 | Blautia argi |
| 301 | 976945 | 977184 | + | NZ_LT593929.1 | Propionibacterium freudenreichii |
| 302 | 1126951 | 1127181 | - | NC_007519.1 | Desulfovibrio alaskensis G20 |
| 303 | 3411800 | 3412060 | + | NC_016631.1 | Granulicella mallensis MP5ACTX8 |
| 304 | 1104765 | 1104998 | + | NC_015500.1 | Treponema brennaborense DSM 12168 |
| 305 | 1276316 | 1276543 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 306 | 2001725 | 2001958 | + | NZ_CP042829.1 | Tepidiforma bonchosmolovskayae |
| 307 | 854076 | 854303 | - | NZ_LT996885.1 | Dialister massiliensis |
| 308 | 257157 | 257387 | - | NC_013939.1 | Deferribacter desulfuricans SSM1 |
| 309 | 937944 | 938135 | - | NZ_CP035485.1 | Salicibibacter halophilus |
| 310 | 270516 | 270746 | + | NZ_CP070062.1 | Coprococcus comes |
| 311 | 1290217 | 1290450 | + | NZ_CP036150.1 | Oceanispirochaeta crateris |
| 312 | 577939 | 578127 | + | NZ_CP019606.1 | Tessaracoccus aquimaris |
| 313 | 1280051 | 1280278 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 314 | 948402 | 948629 | - | NZ_CP031092.1 | Salicibibacter kimchii |
| 315 | 1377667 | 1377909 | - | NZ_CP021255.1 | Desulfobulbus oralis |
| 316 | 2205207 | 2205404 | + | NZ_CP040635.1 | Acidipropionibacterium jensenii |
| 317 | 1302925 | 1303125 | + | NC_015588.1 | Isoptericola variabilis 225 |
| 318 | 457311 | 457523 | + | NZ_CP035495.1 | Xylanimonas allomyrinae |
| 319 | 6262819 | 6263070 | - | NC_010162.1 | Sorangium cellulosum So ce56 |
| 320 | 1546641 | 1546832 | - | NZ_CP060789.1 | Tessaracoccus defluvii |
| 321 | 946565 | 946795 | + | NC_014220.1 | Syntrophothermus lipocalidus DSM 12680 |
| 322 | 1516283 | 1516507 | + | NC_014246.1 | Mobiluncus curtisii ATCC 43063 |
| 323 | 3915211 | 3915444 | - | NC_013739.1 | Conexibacter woesei DSM 14684 |
| 324 | 7858585 | 7858815 | - | NC_019673.1 | Saccharothrix espanaensis DSM 44229 |
| 325 | 1190981 | 1191166 | + | NZ_CP035504.1 | Kocuria indica |
| 326 | 2234299 | 2234520 | - | NC_016024.1 | Chloracidobacterium thermophilum B |
| 327 | 640660 | 640911 | + | NZ_CP016211.1 | Minicystis rosea |
| 328 | 4421533 | 4421763 | + | NZ_CP016793.1 | Lentzea guizhouensis |
| 329 | 1468828 | 1469025 | + | NZ_CP025198.1 | Acidipropionibacterium virtanenii |
| 330 | 793164 | 793361 | - | NZ_CP019400.1 | Acidipropionibacterium acidipropionici |
| 331 | 9505984 | 9506214 | - | NZ_CP034550.1 | Saccharothrix syringae |
| 332 | 253631 | 253861 | - | NZ_LT990039.1 | Massilistercora timonensis |
| 333 | 5314079 | 5314306 | + | NZ_CP012159.1 | Chondromyces crocatus |
| 334 | 2388777 | 2388989 | - | NZ_CP039291.1 | Cellulomonas shaoxiangyii |
| 335 | 418271 | 418492 | + | NZ_CP018135.1 | Neomicrococcus aestuarii |
| 336 | 613765 | 613995 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 337 | 2052300 | 2052530 | - | NZ_CP031422.1 | Microbacterium oxydans |
| 338 | 2734985 | 2735215 | + | NZ_CP049255.1 | Microbacterium endophyticum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002570.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01245.22 | 0.8 | 264 | 1700.0 | same-strand | Ribosomal protein L19 |
| 2 | PF01746.23 | 0.92 | 305 | 619 | same-strand | tRNA (Guanine-1)-methyltransferase |
| 3 | PF01782.20 | 0.98 | 323 | 91.5 | same-strand | RimM N-terminal domain |
| 4 | PF05239.18 | 0.88 | 292 | 98.0 | same-strand | PRC-barrel domain |
| 5 | PF00886.21 | 1.0 | 330 | 24.0 | same-strand | Ribosomal protein S16 |
| 6 | PF00448.24 | 0.95 | 315 | 413.5 | same-strand | SRP54-type protein, GTPase domain |
| 7 | PF02978.21 | 0.95 | 315 | 360 | same-strand | Signal peptide binding domain |
| 8 | PF02881.21 | 0.95 | 315 | 411.0 | same-strand | SRP54-type protein, helical bundle domain |
| 9 | PF04297.16 | 0.72 | 237 | 1735.5 | same-strand | Putative helix-turn-helix protein, YlxM / p13 like |
++ More..