Result : Q9KA06
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0435 protein BH2488 |
| NCBI Accession ID | BA000004.3 |
| Organism | Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
| Left | 2607754 |
| Right | 2607975 |
| Strand | + |
| Nucleotide Sequence | ATGAATTTAAACGAGGAAAGCCGAGAAAATGTCGTGTTTATGATCGAGGAAATTAAAAAGAAGCTCCAAGTTGTAAATGGGTCTGTTCTCAACCCAGATAGTGTGGATATGAGCCGCTACGAGGACTTACGAGACATTTATGACATGATTAAAAAGAAAAACAACTTCAGCGTCAGCGAAATGGATGCGATCGCCGTCGAGCTAGGAAGGCTTCGCAAATAA |
| Sequence | MNLNEESRENVVFMIEEIKKKLQVVNGSVLNPDSVDMSRYEDLRDIYDMIKKKNNFSVSEMDAIAVELGRLRK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23968. Profile Description: Protein of unknown function (DUF1128). This family consists of several short, hypothetical bacterial proteins of unknown function. |
| Pubmed ID | 11058132 |
| Domain | CDD:420123 |
| Functional Category | Others |
| Uniprot ID | Q9KA06 |
| ORF Length (Amino Acid) | 73 |
++ More..
| Conservation Analysis |
No. of Species: 37
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2607754 | 2607975 | + | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 2 | 2348208 | 2348432 | + | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 3 | 551212 | 551442 | + | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 4 | 2730029 | 2730253 | + | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 5 | 5871683 | 5871913 | - | NZ_CP034235.1 | Paenibacillus psychroresistens |
| 6 | 990496 | 990717 | - | NZ_CP016538.2 | Planococcus maritimus |
| 7 | 1001986 | 1002207 | - | NZ_CP059540.1 | Planococcus maritimus |
| 8 | 3650966 | 3651193 | + | NZ_CP016020.1 | Bacillus weihaiensis |
| 9 | 701256 | 701477 | + | NC_017672.3 | Paenibacillus mucilaginosus K02 |
| 10 | 3394198 | 3394422 | - | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 11 | 1151858 | 1152082 | - | NZ_CP042593.1 | Bacillus dafuensis |
| 12 | 3917643 | 3917864 | + | NZ_AP017312.1 | Aneurinibacillus soli |
| 13 | 729088 | 729309 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 14 | 1014017 | 1014238 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 15 | 3776545 | 3776787 | - | NZ_CP013652.1 | Paenibacillus naphthalenovorans |
| 16 | 179281 | 179502 | - | NZ_CP033433.1 | Cohnella candidum |
| 17 | 953988 | 954209 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 18 | 923408 | 923629 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 19 | 3343447 | 3343668 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 20 | 816646 | 816870 | - | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 21 | 1050835 | 1051056 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 22 | 806617 | 806838 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 23 | 78391 | 78615 | + | NZ_CP070511.1 | Parageobacillus toebii |
| 24 | 339209 | 339439 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 25 | 775546 | 775767 | + | NZ_CP013661.2 | Planococcus kocurii |
| 26 | 993940 | 994161 | - | NZ_CP019401.1 | Planococcus faecalis |
| 27 | 3065885 | 3066109 | - | NZ_CP030926.1 | Peribacillus butanolivorans |
| 28 | 748958 | 749185 | + | NZ_CP022983.1 | Cytobacillus kochii |
| 29 | 994646 | 994873 | + | NZ_CP041305.1 | Cytobacillus ciccensis |
| 30 | 1987320 | 1987544 | + | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 31 | 936699 | 936920 | - | NZ_CP016540.2 | Planococcus versutus |
| 32 | 3602649 | 3602873 | - | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 33 | 295307 | 295534 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 34 | 324484 | 324672 | - | NZ_CP012152.1 | Anoxybacillus gonensis |
| 35 | 441632 | 441817 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 36 | 1332370 | 1332552 | - | NZ_CP065729.1 | Macrococcus caseolyticus |
| 37 | 1850000 | 1850182 | - | NZ_CP047361.1 | Macrococcus canis |
| 38 | 1769479 | 1769700 | + | NC_003210.1 | Listeria monocytogenes EGD-e |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP016538.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF03631.17 | 0.73 | 27 | 1262.0 | opposite-strand | Virulence factor BrkB |
++ More..