Result : Q9K9Q1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0298 protein BH2594 |
| NCBI Accession ID | BA000004.3 |
| Organism | Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
| Left | 2716585 |
| Right | 2716863 |
| Strand | - |
| Nucleotide Sequence | ATGCTTACTAGCAATCGCCAAGGCATGGCTGTCTACCTCACATCATTAAAATTTGCACGACAACTTAGACGTTTCGGGTACGTCCACTATGTTTCGAAAAAAATGAGATATGTCGTTTTATATTGCAACGAAGAAGCTGTCCAAACGACGATGGAGAAGCTTCAATCATTTCATTTTGTAAAAGACGTTCAGCTTTCCATGCGCCCTTATGTGCAAACAGAGTTTCAAAATGCAAAGCCTGATAAAGCGAAAGAGTACGATTATAAGATGGGTTTATAA |
| Sequence | MLTSNRQGMAVYLTSLKFARQLRRFGYVHYVSKKMRYVVLYCNEEAVQTTMEKLQSFHFVKDVQLSMRPYVQTEFQNAKPDKAKEYDYKMGL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23792. Profile Description: Uncharacterized protein conserved in bacteria (DUF2129). hypothetical protein; Provisional |
| Pubmed ID | 11058132 |
| Domain | CDD:420011 |
| Functional Category | Others |
| Uniprot ID | Q9K9Q1 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 59
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2716585 | 2716863 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 2 | 2442997 | 2443269 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 3 | 2829369 | 2829644 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 4 | 3295448 | 3295723 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 5 | 1458853 | 1459128 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 6 | 2762085 | 2762318 | - | NZ_LS483476.1 | Lederbergia lentus |
| 7 | 253301 | 253576 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 8 | 4085318 | 4085560 | - | NZ_CP024035.1 | Priestia aryabhattai |
| 9 | 1261509 | 1261784 | + | NZ_CP012024.1 | Bacillus smithii |
| 10 | 4126015 | 4126290 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 11 | 1054064 | 1054339 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 12 | 929921 | 930193 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 13 | 3740524 | 3740796 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 14 | 1651471 | 1651746 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 15 | 2945701 | 2945973 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 16 | 1354457 | 1354690 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 17 | 2630417 | 2630659 | - | NZ_CP017560.1 | Sporosarcina ureilytica |
| 18 | 34138 | 34413 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 19 | 5066617 | 5066892 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 20 | 3856007 | 3856279 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 21 | 3378165 | 3378437 | - | NZ_CP014616.1 | Sporosarcina psychrophila |
| 22 | 1878916 | 1879158 | - | NZ_CP038012.1 | Sporosarcina pasteurii |
| 23 | 2938063 | 2938296 | + | NZ_CP013661.2 | Planococcus kocurii |
| 24 | 2325400 | 2325633 | - | NZ_CP019401.1 | Planococcus faecalis |
| 25 | 2669832 | 2670107 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 26 | 2052354 | 2052629 | + | NZ_CP053989.1 | Niallia circulans |
| 27 | 2131221 | 2131463 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 28 | 2667879 | 2668154 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 29 | 1952453 | 1952728 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 30 | 2190599 | 2190841 | - | NZ_CP016540.2 | Planococcus versutus |
| 31 | 1282071 | 1282313 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 32 | 2280755 | 2280988 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 33 | 2467412 | 2467654 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 34 | 2051085 | 2051327 | - | NZ_CP016538.2 | Planococcus maritimus |
| 35 | 1560098 | 1560373 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 36 | 2176403 | 2176636 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 37 | 2028813 | 2029055 | - | NZ_CP016539.2 | Planococcus plakortidis |
| 38 | 2074335 | 2074577 | - | NZ_CP059540.1 | Planococcus maritimus |
| 39 | 1847312 | 1847554 | - | NZ_CP013659.2 | Planococcus rifietoensis |
| 40 | 1745717 | 1745962 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 41 | 2435970 | 2436245 | - | NZ_CP011937.1 | Bacillus velezensis |
| 42 | 1524897 | 1525172 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 43 | 1541808 | 1542047 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 44 | 1568951 | 1569196 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 45 | 1476359 | 1476604 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 46 | 1535481 | 1535726 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 47 | 1573017 | 1573262 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 48 | 418271 | 418516 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 49 | 1578696 | 1578971 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 50 | 3796348 | 3796572 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 51 | 3962733 | 3962957 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 52 | 3956100 | 3956324 | - | NC_011725.1 | Bacillus cereus B4264 |
| 53 | 1696097 | 1696369 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 54 | 1673455 | 1673727 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 55 | 2482380 | 2482610 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 56 | 1694013 | 1694285 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 57 | 3495320 | 3495592 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 58 | 949072 | 949329 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 59 | 515577 | 515864 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 60 | 2862704 | 2862973 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LS483476.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01467.28 | 1.0 | 59 | 1475.0 | same-strand | Cytidylyltransferase-like |
| 2 | PF03602.17 | 1.0 | 59 | 899.5 | same-strand | Conserved hypothetical protein 95 |
| 3 | PF06133.13 | 1.0 | 59 | 210.5 | same-strand | Control of competence regulator ComK, YlbF/YmcA |
| 4 | PF07670.16 | 0.61 | 36 | 2011.0 | opposite-strand | Nucleoside recognition |
| 5 | PF14003.8 | 0.61 | 36 | 1137.0 | same-strand | YlbE-like protein |
| 6 | PF14071.8 | 0.63 | 37 | 1391 | same-strand | Putative coat protein |
| 7 | PF00188.28 | 0.61 | 36 | 1858 | same-strand | Cysteine-rich secretory protein family |
++ More..