Result : Q9K9K7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0223 protein BH2638 |
| NCBI Accession ID | BA000004.3 |
| Organism | Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
| Left | 2758294 |
| Right | 2758560 |
| Strand | - |
| Nucleotide Sequence | ATGAAAACAACGTTGCCAATATCGCTTGATTGGTCAACCGAGGAAGTGATCGATGTGGTTCACTTTTTCCAAGCGATCGAACAAGCATACGATCAAGGGATTGCCCGAGAGGATTTACTCGGTAAATATCGTAGGTTTAAAGAAATCGTTCCCTCCAAAAGTGAAGAGAAACAATTGTTCCGCGCATATGAGCAGGAAAACGATGTGTCCTGCTACCAAACGATAAAAAAAGCGCGAGAAGAAATGGAAGAGCATATTCAAATGTGA |
| Sequence | MKTTLPISLDWSTEEVIDVVHFFQAIEQAYDQGIAREDLLGKYRRFKEIVPSKSEEKQLFRAYEQENDVSCYQTIKKAREEMEEHIQM |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl23825. Profile Description: Uncharacterized protein family (UPF0223). hypothetical protein; Provisional |
| Pubmed ID | 11058132 |
| Domain | CDD:420035 |
| Functional Category | Others |
| Uniprot ID | Q9K9K7 |
| ORF Length (Amino Acid) | 88 |
++ More..
| Conservation Analysis |
No. of Species: 45
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2758294 | 2758560 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
| 2 | 2474617 | 2474889 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 3 | 1252578 | 1252847 | + | NZ_CP031223.1 | Psychrobacillus glaciei |
| 4 | 3261891 | 3262166 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
| 5 | 2158783 | 2159061 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 6 | 893750 | 894037 | + | NZ_CP006837.1 | Lysinibacillus varians |
| 7 | 3775907 | 3776194 | - | NZ_CP019980.1 | Lysinibacillus sphaericus |
| 8 | 1230538 | 1230762 | + | NZ_CP012024.1 | Bacillus smithii |
| 9 | 2697305 | 2697574 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 10 | 1337063 | 1337332 | + | NZ_CP024035.1 | Priestia aryabhattai |
| 11 | 1463346 | 1463612 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 12 | 1641853 | 1642104 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 13 | 2906257 | 2906529 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 14 | 3886035 | 3886322 | - | NZ_CP010820.1 | Lysinibacillus fusiformis |
| 15 | 2097830 | 2098105 | - | NZ_CP059540.1 | Planococcus maritimus |
| 16 | 2695302 | 2695571 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 17 | 2075490 | 2075765 | - | NZ_CP016538.2 | Planococcus maritimus |
| 18 | 2090763 | 2091026 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 19 | 918242 | 918511 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 20 | 488206 | 488478 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 21 | 2517959 | 2518252 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 22 | 2275338 | 2275634 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 23 | 1664461 | 1664712 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 24 | 2788666 | 2788935 | - | NZ_LS483476.1 | Lederbergia lentus |
| 25 | 1507795 | 1508061 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 26 | 1555275 | 1555550 | + | NZ_CP023704.1 | Caldibacillus thermoamylovorans |
| 27 | 2913209 | 2913487 | + | NZ_CP013661.2 | Planococcus kocurii |
| 28 | 1676791 | 1677063 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 29 | 2350210 | 2350488 | - | NZ_CP019401.1 | Planococcus faecalis |
| 30 | 1441220 | 1441486 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 31 | 2540562 | 2540837 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 32 | 2208403 | 2208684 | - | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 33 | 1712848 | 1713114 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 34 | 1535936 | 1536202 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 35 | 1038765 | 1038980 | + | NZ_CP011366.1 | Salinicoccus halodurans |
| 36 | 2200394 | 2200672 | - | NZ_CP016543.2 | Planococcus donghaensis |
| 37 | 1656070 | 1656321 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 38 | 2491362 | 2491640 | - | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 39 | 2304846 | 2305124 | - | NZ_CP016537.2 | Planococcus halocryophilus |
| 40 | 3847914 | 3848183 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 41 | 1307151 | 1307378 | + | NZ_CP015438.1 | Anoxybacillus amylolyticus |
| 42 | 1655797 | 1656066 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 43 | 1442716 | 1442940 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 44 | 1435712 | 1435981 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 45 | 1823853 | 1824131 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 46 | 1584612 | 1584833 | - | NZ_CP065712.1 | Staphylococcus auricularis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002570.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17259.4 | 0.6 | 27 | 2021.0 | opposite-strand | Family of unknown function (DUF5325) |
| 2 | PF00459.27 | 0.96 | 43 | 1238.5 | same-strand | Inositol monophosphatase family |
| 3 | PF06335.14 | 0.78 | 35 | 51.5 | opposite-strand | Protein of unknown function (DUF1054) |
| 4 | PF01276.22 | 0.84 | 38 | 1117 | opposite-strand | Orn/Lys/Arg decarboxylase, major domain |
++ More..