Protein Information |
Information Type | Description |
---|---|
Protein name | Cell division protein ZapA (Z ring-associated protein ZapA) |
NCBI Accession ID | BA000004.3 |
Organism | Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) |
Left | 3226888 |
Right | 3227163 |
Strand | - |
Nucleotide Sequence | GTGAAAGAGAGACAAAGAGAAAAGCAGCGTACCACCGTCTCGATTTATGGACAGCAGTATACGGTTGCTGGCTATGATAGTCCCGAATACATGAAAGAAGTGGCCGCTGAAATTGATGCAAAAATGCGTGAACTACGGAAGGTTAATCCGTACTTAGATACAACGAGACTAGCCGTATTAACGGCCGTAAATGTGATGGATGATTTAAAAAAATTGGAAGAGTACATTCGTTATTTAGAACAGCAGAGATTAACAGGAGACGAAAAAAATGCTTAG |
Sequence | MKERQREKQRTTVSIYGQQYTVAGYDSPEYMKEVAAEIDAKMRELRKVNPYLDTTRLAVLTAVNVMDDLKKLEEYIRYLEQQRLTGDEKNA |
Source of smORF | Swiss-Prot |
Function | Activator of cell division through the inhibition of FtsZ GTPase activity, therefore promoting FtsZ assembly into bundles of protofilaments necessary for the formation of the division Z ring. It is recruited early at mid-cell but it is not essential for cell division (By similarity). {ECO:0000250}. |
Pubmed ID | 11058132 |
Domain | CDD:412769 |
Functional Category | Others |
Uniprot ID | Q9K897 |
ORF Length (Amino Acid) | 91 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 3226888 | 3227163 | - | NC_002570.2 | Alkalihalobacillus halodurans C-125 |
2 | 1428808 | 1429062 | + | NZ_CP065425.1 | Heyndrickxia vini |
3 | 2464090 | 2464362 | - | NZ_CP012024.1 | Bacillus smithii |
4 | 2764988 | 2765245 | - | NZ_CP053376.1 | Bacillus amyloliquefaciens |
5 | 1222637 | 1222894 | + | NZ_CP011937.1 | Bacillus velezensis |
6 | 2891329 | 2891586 | - | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
7 | 3078110 | 3078367 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
8 | 1461993 | 1462220 | + | NZ_LS483476.1 | Lederbergia lentus |
9 | 3266187 | 3266444 | - | NZ_LT603683.1 | Bacillus glycinifermentans |
10 | 835372 | 835638 | + | NZ_CP034118.1 | Staphylospora marina |
11 | 3305174 | 3305443 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
12 | 3709327 | 3709587 | + | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
13 | 2925640 | 2925897 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
14 | 813544 | 813813 | + | NZ_CP040336.1 | Bacillus luti |
15 | 4386077 | 4386346 | - | NZ_CP064875.1 | Bacillus toyonensis |
16 | 4362341 | 4362610 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
17 | 4522120 | 4522389 | - | NC_011725.1 | Bacillus cereus B4264 |
18 | 4555882 | 4556151 | - | NZ_CP032365.1 | Bacillus wiedmannii |
19 | 2730640 | 2730897 | - | NZ_CP051464.1 | Bacillus mojavensis |
20 | 2802538 | 2802795 | - | NZ_CP013984.1 | Bacillus inaquosorum |
21 | 2742626 | 2742883 | - | NZ_CP048852.1 | Bacillus tequilensis |
22 | 2736074 | 2736331 | - | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
23 | 2830186 | 2830443 | + | NZ_CP017786.1 | Bacillus xiamenensis |
24 | 2741423 | 2741680 | + | NZ_CP043404.1 | Bacillus safensis |
25 | 971294 | 971566 | - | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
26 | 2809115 | 2809372 | - | NZ_CP033052.1 | Bacillus vallismortis |
27 | 3370886 | 3371143 | + | NZ_CP029364.1 | Bacillus halotolerans |
28 | 2481627 | 2481887 | - | NZ_CP029797.1 | Paraliobacillus zengyii |
29 | 3974887 | 3975144 | - | NZ_CP017703.1 | Aeribacillus pallidus |
30 | 2843170 | 2843430 | + | NZ_CP063356.1 | Anaerobacillus isosaccharinicus |
31 | 2717225 | 2717476 | - | NC_006510.1 | Geobacillus kaustophilus HTA426 |
32 | 1548588 | 1548842 | - | NZ_CP065712.1 | Staphylococcus auricularis |
33 | 569876 | 570127 | + | NZ_CP014342.1 | Geobacillus subterraneus |
34 | 3257710 | 3257970 | + | NZ_CP018622.1 | Virgibacillus dokdonensis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03994.16 | 0.68 | 23 | 4755 | same-strand | Domain of Unknown Function (DUF350) |
2 | PF00488.23 | 1.0 | 34 | 2354.0 | same-strand | MutS domain V |
3 | PF01713.23 | 1.0 | 34 | 2354.0 | same-strand | Smr domain |
4 | PF14791.8 | 0.97 | 33 | 623 | same-strand | DNA polymerase beta thumb |
5 | PF14716.8 | 1.0 | 34 | 629.5 | same-strand | Helix-hairpin-helix domain |
6 | PF02674.18 | 1.0 | 34 | 7.0 | same-strand | Colicin V production protein |
7 | PF17759.3 | 0.79 | 27 | 1188 | same-strand | Phenylalanyl tRNA synthetase beta chain CLM domain |
8 | PF03483.19 | 0.79 | 27 | 1188 | same-strand | B3/4 domain |
9 | PF03147.16 | 0.79 | 27 | 1188 | same-strand | Ferredoxin-fold anticodon binding domain |
10 | PF01588.22 | 0.79 | 27 | 1188 | same-strand | Putative tRNA binding domain |
11 | PF03484.17 | 0.79 | 27 | 1188 | same-strand | tRNA synthetase B5 domain |
12 | PF01409.22 | 0.74 | 25 | 3542 | same-strand | tRNA synthetases class II core domain (F) |
13 | PF02912.20 | 0.74 | 25 | 3542 | same-strand | Aminoacyl tRNA synthetase class II, N-terminal domain |
14 | PF01351.20 | 0.94 | 32 | 134.0 | opposite-strand | Ribonuclease HII |
15 | PF11858.10 | 0.94 | 32 | 134.0 | opposite-strand | Domain of unknown function (DUF3378) |
16 | PF14520.8 | 0.94 | 32 | 636 | same-strand | Helix-hairpin-helix domain |