Result : Q9K548
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ESAT-6-like protein EsxC (ORF3890c) |
| NCBI Accession ID | AJ250015.1 |
| Organism | Mycolicibacterium paratuberculosis (strain ATCC BAA-968 / K-10) (Mycobacterium paratuberculosis) |
| Left | 83 |
| Right | 370 |
| Strand | - |
| Nucleotide Sequence | ATGTCCGACCCGATCACTTACAACCCGGGCGCGGTGGCCGACTTCGCCACCGACGTCGCCTCCCGCGCCGGCCAGTTGCAGTCCATTTTCGACGACACCTCCAACCGCACGCACGCCCTGCAGGAATTCTTCGCCGGGCACGGCGCGTCGGGCTTTTTCGAGGCGCAGGCCCAGATGCTGTCCGGGCTGCAGGGGCTCATCGACACGATCCGCCAGCACGGGCAGACCACCTCGCACGTGCTGGACAGCGCGATCAGCACGGACCAGCACATCGCCGGCCTGTTCTGA |
| Sequence | MSDPITYNPGAVADFATDVASRAGQLQSIFDDTSNRTHALQEFFAGHGASGFFEAQAQMLSGLQGLIDTIRQHGQTTSHVLDSAISTDQHIAGLF |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl02005. Profile Description: Proteins of 100 residues with WXG. T7SS_ESX-EspC is a family of exported virulence proteins from largely Acinetobacteria and a few Fimicutes, Gram-positive bacteria. It is exported in conjunction with EspA as an interacting pair.ED F8ADQ6.1/227-313; F8ADQ6.1/227-313; |
| Pubmed ID | 16116077 |
| Domain | CDD:413154 |
| Functional Category | Others |
| Uniprot ID | Q9K548 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 26
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 144396 | 144683 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 2 | 139193 | 139480 | + | NZ_CP023147.1 | Mycobacterium marseillense |
| 3 | 158427 | 158714 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 4 | 154304 | 154591 | + | NC_016948.1 | Mycobacterium paraintracellulare |
| 5 | 4765675 | 4765962 | + | NZ_AP022590.1 | Mycobacterium mantenii |
| 6 | 4320028 | 4320315 | + | NZ_AP022614.1 | Mycobacterium parmense |
| 7 | 4197830 | 4198120 | - | NZ_AP022582.1 | Mycobacterium seoulense |
| 8 | 4003706 | 4003996 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 9 | 3827291 | 3827578 | - | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 10 | 2244670 | 2244957 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 11 | 4373726 | 4374013 | - | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 12 | 4444145 | 4444432 | - | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 13 | 4613033 | 4613320 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 14 | 3195212 | 3195499 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 15 | 5571775 | 5572062 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 16 | 1433338 | 1433625 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 17 | 5610153 | 5610443 | + | NZ_AP022613.1 | Mycobacterium conspicuum |
| 18 | 1902654 | 1902941 | + | NZ_AP022562.1 | Mycobacterium novum |
| 19 | 56041 | 56328 | - | NC_015576.1 | Mycolicibacter sinensis |
| 20 | 47940 | 48227 | - | NZ_LT906469.1 | Mycolicibacter terrae |
| 21 | 1924668 | 1924901 | - | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 22 | 2554634 | 2554921 | + | NZ_AP022596.1 | Mycolicibacterium helvum |
| 23 | 4353713 | 4354000 | + | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 24 | 3894254 | 3894547 | - | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 25 | 155145 | 155429 | + | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 26 | 4214308 | 4214601 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_AP022614.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00934.22 | 0.92 | 24 | 1690.0 | same-strand | PE family |
| 2 | PF00823.21 | 0.96 | 25 | 473.0 | same-strand | PPE family |
| 3 | PF06013.14 | 1.0 | 26 | 47.5 | same-strand | Proteins of 100 residues with WXG |
| 4 | PF14011.8 | 1.0 | 26 | 108.0 | same-strand | EspG family |
| 5 | PF08817.12 | 0.81 | 21 | 2058 | same-strand | WXG100 protein secretion system (Wss), protein YukD |
| 6 | PF11203.10 | 0.96 | 25 | 5255 | same-strand | Putative type VII ESX secretion system translocon, EccE |
++ More..