Result : Q9K3A9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized membrane protein YdzM/YouB |
| NCBI Accession ID | AF029355.1 |
| Organism | Bacillus subtilis (strain 168) |
| Left | 928 |
| Right | 1104 |
| Strand | + |
| Nucleotide Sequence | ATGAACAACAAGAAAAATATCTTTGATATTGTTATGTACATTATTTTCGGTGTGTTAAGTCTTTTTCTAGTTGCAAAAACTGATTATGGCACTGGAGTTTTAGTGTTTGTTGCAATTTTATACCTCGCTGTTATTGCTTATAAAATTAAGCAAGTATTTAGTAATTCAGATTCTTAA |
| Sequence | MNNKKNIFDIVMYIIFGVLSLFLVAKTDYGTGVLVFVAILYLAVIAYKIKQVFSNSDS |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 10931276 9384377 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9K3A9 |
| ORF Length (Amino Acid) | 58 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 556562 | 556738 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 2 | 2247367 | 2247543 | - | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 3 | 2080479 | 2080655 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 4 | 2105036 | 2105212 | - | NZ_CP023665.1 | Bacillus paralicheniformis |
++ More..