Protein Information |
Information Type | Description |
---|---|
Protein name | Bacteriocin ubericin-A |
NCBI Accession ID | EF203953.1 |
Organism | Streptococcus uberis |
Left | 294 |
Right | 506 |
Strand | + |
Nucleotide Sequence | ATGAATACAATTGAAAAATTTGAAAATATTAAACTTTTTTCACTAAAGAAAATTATCGGTGGCAAAACTGTAAATTATGGTAATGGCCTTTATTGTAACCAAAAAAAATGCTGGGTAAACTGGTCAGAAACTGCTACAACAATAGTAAATAATTCCATCATGAACGGGCTCACAGGTGGTAATGCGGGTTGGCACTCAGGCGGGAGAGCATAA |
Sequence | MNTIEKFENIKLFSLKKIIGGKTVNYGNGLYCNQKKCWVNWSETATTIVNNSIMNGLTGGNAGWHSGGRA |
Source of smORF | Swiss-Prot |
Function | Heat-stable antibiotic with bacteriolytic activity against Listeria spp., E.hirae, E.faecalis ATCC 19433, S.bovis 83, S.uberis 42 and L.lactis. |
Pubmed ID | 17933926 |
Domain | CDD:366773 |
Functional Category | Antimicrobial |
Uniprot ID | A9Q0M7 |
ORF Length (Amino Acid) | 70 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1948256 | 1948441 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
2 | 1801151 | 1801336 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
3 | 447175 | 447360 | - | NZ_CP014699.1 | Streptococcus pantholopis |
4 | 451478 | 451696 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04397.17 | 0.75 | 3 | 2048.0 | same-strand | LytTr DNA-binding domain |
2 | PF00072.26 | 0.75 | 3 | 2476 | same-strand | Response regulator receiver domain |
3 | PF08951.12 | 1.0 | 4 | 0 | same-strand | Enterocin A Immunity |
4 | PF03047.16 | 0.75 | 3 | 1549 | same-strand | COMC family |
5 | PF10439.11 | 0.75 | 3 | 811.0 | same-strand | Bacteriocin class II with double-glycine leader peptide |