Result : A9Q0M7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Bacteriocin ubericin-A |
| NCBI Accession ID | EF203953.1 |
| Organism | Streptococcus uberis |
| Left | 294 |
| Right | 506 |
| Strand | + |
| Nucleotide Sequence | ATGAATACAATTGAAAAATTTGAAAATATTAAACTTTTTTCACTAAAGAAAATTATCGGTGGCAAAACTGTAAATTATGGTAATGGCCTTTATTGTAACCAAAAAAAATGCTGGGTAAACTGGTCAGAAACTGCTACAACAATAGTAAATAATTCCATCATGAACGGGCTCACAGGTGGTAATGCGGGTTGGCACTCAGGCGGGAGAGCATAA |
| Sequence | MNTIEKFENIKLFSLKKIIGGKTVNYGNGLYCNQKKCWVNWSETATTIVNNSIMNGLTGGNAGWHSGGRA |
| Source of smORF | Swiss-Prot |
| Function | Heat-stable antibiotic with bacteriolytic activity against Listeria spp., E.hirae, E.faecalis ATCC 19433, S.bovis 83, S.uberis 42 and L.lactis. |
| Pubmed ID | 17933926 |
| Domain | CDD:366773 |
| Functional Category | Antimicrobial |
| Uniprot ID | A9Q0M7 |
| ORF Length (Amino Acid) | 70 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1948256 | 1948441 | - | NZ_CP039457.1 | Streptococcus pasteurianus |
| 2 | 1801151 | 1801336 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 3 | 447175 | 447360 | - | NZ_CP014699.1 | Streptococcus pantholopis |
| 4 | 451478 | 451696 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP014699.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF04397.17 | 0.75 | 3 | 2048.0 | same-strand | LytTr DNA-binding domain |
| 2 | PF00072.26 | 0.75 | 3 | 2476 | same-strand | Response regulator receiver domain |
| 3 | PF08951.12 | 1.0 | 4 | 0 | same-strand | Enterocin A Immunity |
| 4 | PF03047.16 | 0.75 | 3 | 1549 | same-strand | COMC family |
| 5 | PF10439.11 | 0.75 | 3 | 811.0 | same-strand | Bacteriocin class II with double-glycine leader peptide |
++ More..