Result : Q9JYC2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0237 protein NMB1653 |
| NCBI Accession ID | AE002098.2 |
| Organism | Neisseria meningitidis serogroup B (strain MC58) |
| Left | 1721032 |
| Right | 1721304 |
| Strand | - |
| Nucleotide Sequence | GTGAACAATTCAGTCATCACCGTCATCGGTAAAGACCGCGTCGGCATCGTGTACGATGTTTCCAAAATTTTGGCGGAAAACCAAATCAATATTCTCAACATCAGCCAACAGCTGATGGACGATTTTTTTACTATGATTATCTTGGTGGACACTTCAAAATGCAGCAAATCGCGTCAAGAGGTTTTGGATTTGTTTGCGGAAGAGAGCAAAAAACTCGCGCTTGATATCCGTATGCAAAACGAAGAAATCTTCCAAGCGATGCACCGCATTTGA |
| Sequence | MNNSVITVIGKDRVGIVYDVSKILAENQINILNISQQLMDDFFTMIILVDTSKCSKSRQEVLDLFAEESKKLALDIRMQNEEIFQAMHRI |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09141. Profile Description: ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme. The ACT domain is a structural motif of 70-90 amino acids that functions in the control of metabolism, solute transport and signal transduction. They are thus found in a variety of different proteins in a variety of different arrangements. In mammalian phenylalanine hydroxylase the domain forms no contacts but promotes an allosteric effect despite the apparent lack of ligand binding. |
| Pubmed ID | 10710307 |
| Domain | CDD:415594 |
| Functional Category | Others |
| Uniprot ID | Q9JYC2 |
| ORF Length (Amino Acid) | 90 |
++ More..
| Conservation Analysis |
No. of Species: 44
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1294198 | 1294470 | - | NZ_CP039887.1 | Neisseria subflava |
| 2 | 1176993 | 1177265 | - | NZ_CP039886.1 | Neisseria flavescens |
| 3 | 551987 | 552259 | - | NZ_CP031325.1 | Neisseria polysaccharea |
| 4 | 1267584 | 1267856 | - | NZ_CP021520.1 | Neisseria meningitidis |
| 5 | 1377129 | 1377401 | - | NZ_CP031253.1 | Neisseria lactamica |
| 6 | 1111251 | 1111523 | - | NZ_LS483369.1 | Neisseria cinerea |
| 7 | 272864 | 273136 | - | NZ_CP012028.1 | Neisseria gonorrhoeae |
| 8 | 293798 | 294070 | - | NZ_CP046027.1 | Neisseria brasiliensis |
| 9 | 1442936 | 1443208 | - | NZ_CP072524.1 | Neisseria sicca |
| 10 | 446046 | 446318 | - | NZ_LR134533.1 | Neisseria weaveri |
| 11 | 1421525 | 1421797 | - | NZ_LR134516.1 | Neisseria animaloris |
| 12 | 1647038 | 1647310 | - | NZ_LT906434.1 | Neisseria zoodegmatis |
| 13 | 2075520 | 2075795 | + | NZ_CP022278.1 | Neisseria chenwenguii |
| 14 | 21808 | 22089 | + | NZ_CP031699.1 | Neisseria animalis |
| 15 | 1867899 | 1868171 | - | NZ_CP031700.1 | Neisseria zalophi |
| 16 | 887843 | 888115 | - | NZ_CP060414.1 | Neisseria musculi |
| 17 | 1752292 | 1752564 | - | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 18 | 2085677 | 2085949 | + | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 19 | 2031582 | 2031854 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 20 | 1022683 | 1022955 | + | NZ_CP015031.1 | Basfia succiniciproducens |
| 21 | 1386074 | 1386346 | + | NC_006300.1 | [Mannheimia] succiniciproducens MBEL55E |
| 22 | 1580702 | 1580980 | + | NZ_CP009238.1 | Basilea psittacipulmonis DSM 24701 |
| 23 | 423780 | 424052 | + | NZ_CP031252.1 | Neisseria elongata |
| 24 | 304173 | 304445 | - | NZ_LR134313.1 | Neisseria canis |
| 25 | 1526144 | 1526422 | + | NZ_CP059571.1 | Neisseria bacilliformis |
| 26 | 1218169 | 1218441 | + | NZ_CP059564.1 | Alysiella filiformis |
| 27 | 1255308 | 1255580 | - | NZ_CP059565.1 | Neisseria wadsworthii |
| 28 | 1445985 | 1446257 | + | NZ_CP059563.1 | Conchiformibius steedae |
| 29 | 1625410 | 1625682 | + | NZ_CP019448.1 | Simonsiella muelleri ATCC 29453 |
| 30 | 1220191 | 1220463 | - | NZ_CP059569.1 | Kingella oralis |
| 31 | 559566 | 559850 | + | NZ_CP038018.1 | Eikenella exigua |
| 32 | 97540 | 97824 | - | NZ_LT906482.1 | Eikenella corrodens |
| 33 | 2020233 | 2020484 | - | NZ_CP007446.1 | Snodgrassella alvi wkB2 |
| 34 | 2829115 | 2829384 | - | NZ_HG917868.1 | Clostridium bornimense |
| 35 | 1533382 | 1533639 | - | NZ_CP035807.1 | Thiospirochaeta perfilievii |
| 36 | 1965937 | 1966206 | + | NC_008261.1 | Clostridium perfringens ATCC 13124 |
| 37 | 1113472 | 1113741 | - | NC_016894.1 | Acetobacterium woodii DSM 1030 |
| 38 | 2353905 | 2354174 | + | NC_014624.2 | Eubacterium callanderi |
| 39 | 986975 | 987244 | + | NZ_CP029487.1 | Eubacterium maltosivorans |
| 40 | 4106095 | 4106364 | + | NZ_CP019962.1 | Eubacterium limosum |
| 41 | 1619693 | 1619926 | - | NZ_CP014204.2 | Clostridium baratii |
| 42 | 552285 | 552554 | + | NC_015687.1 | Clostridium acetobutylicum DSM 1731 |
| 43 | 3888277 | 3888552 | - | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 44 | 1821719 | 1821943 | - | NZ_CP019728.1 | Jeotgalibaca dankookensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP039887.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05167.14 | 0.98 | 43 | 16 | same-strand | Uncharacterised ACR (DUF711) |
++ More..