Result : Q9JSS3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA gyrase inhibitor YacG |
| NCBI Accession ID | AL157959.1 |
| Organism | Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) |
| Left | 2105070 |
| Right | 2105279 |
| Strand | + |
| Nucleotide Sequence | ATGGCTGAATCGCGGCAAACACGCCTTCAAGTCAAATGTCCGACCTGTCAAACAGCAGTAGTATGGGAACCCGAAAACGCATTCCGCCCCTTCTGTTCGCAACGCTGCAAACTGATCGACTTGGGCGGATGGGCAGACGGGAAATATACGGTTTCCGGCCAAACGGAAAGTTTGCCGGAAATATCCGAACCCGACATGGCATACCGCTGA |
| Sequence | MAESRQTRLQVKCPTCQTAVVWEPENAFRPFCSQRCKLIDLGGWADGKYTVSGQTESLPEISEPDMAYR |
| Source of smORF | Swiss-Prot |
| Function | Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}. |
| Pubmed ID | 10761919 |
| Domain | CDD:412768 |
| Functional Category | Metal-binding |
| Uniprot ID | Q9JSS3 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 42
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1537103 | 1537312 | + | NZ_CP021520.1 | Neisseria meningitidis |
| 2 | 718882 | 719091 | + | NZ_CP012028.1 | Neisseria gonorrhoeae |
| 3 | 1305811 | 1306020 | - | NZ_CP031325.1 | Neisseria polysaccharea |
| 4 | 1692280 | 1692489 | + | NZ_CP031253.1 | Neisseria lactamica |
| 5 | 39496 | 39705 | - | NZ_LS483369.1 | Neisseria cinerea |
| 6 | 2289124 | 2289306 | + | NZ_CP059569.1 | Kingella oralis |
| 7 | 1610273 | 1610455 | + | NZ_CP038018.1 | Eikenella exigua |
| 8 | 394071 | 394295 | - | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 9 | 733560 | 733742 | + | NZ_LT906482.1 | Eikenella corrodens |
| 10 | 2289898 | 2290089 | - | NZ_CP008781.1 | Burkholderia pseudomallei |
| 11 | 705553 | 705744 | + | NZ_CP009727.1 | Burkholderia mallei |
| 12 | 3175962 | 3176159 | - | NZ_CP066075.1 | Paraburkholderia ginsengisoli |
| 13 | 3865108 | 3865317 | - | NZ_CP051180.1 | Ferrimonas lipolytica |
| 14 | 4193028 | 4193216 | - | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 15 | 3203068 | 3203238 | + | NZ_CP042382.1 | Pistricoccus aurantiacus |
| 16 | 2154855 | 2155076 | + | NC_020813.1 | Bdellovibrio exovorus JSS |
| 17 | 2233316 | 2233507 | - | NZ_CP009555.1 | Burkholderia oklahomensis C6786 |
| 18 | 1845864 | 1846052 | + | NZ_CP041730.1 | Chitinimonas arctica |
| 19 | 3079434 | 3079628 | + | NZ_CP065745.1 | Aeromonas allosaccharophila |
| 20 | 5242622 | 5242810 | + | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 21 | 2820551 | 2820745 | + | NZ_CP044060.1 | Aeromonas veronii |
| 22 | 1278570 | 1278761 | - | NC_007651.1 | Burkholderia thailandensis E264 |
| 23 | 1678608 | 1678805 | - | NZ_CP022989.1 | Paraburkholderia aromaticivorans |
| 24 | 4327458 | 4327655 | + | NC_007951.1 | Paraburkholderia xenovorans LB400 |
| 25 | 387309 | 387491 | - | NZ_CP071325.1 | Photobacterium ganghwense |
| 26 | 529683 | 529877 | - | NZ_AP022188.1 | Aeromonas media |
| 27 | 3505281 | 3505478 | + | NZ_CP024934.1 | Paraburkholderia graminis |
| 28 | 3889617 | 3889814 | + | NC_010681.1 | Paraburkholderia phytofirmans PsJN |
| 29 | 258591 | 258779 | - | NZ_AP018150.1 | Mycoavidus cysteinexigens |
| 30 | 804111 | 804299 | - | NZ_CP022562.1 | Pseudomonas monteilii |
| 31 | 1813083 | 1813268 | - | NZ_CP024608.1 | Massilia violaceinigra |
| 32 | 2007292 | 2007516 | - | NZ_CP061081.1 | Marinomonas arctica |
| 33 | 3530291 | 3530488 | + | NZ_CP024941.1 | Paraburkholderia terricola |
| 34 | 2893053 | 2893235 | + | NZ_AP021881.1 | Sulfuriferula nivalis |
| 35 | 650601 | 650798 | - | NZ_LR699119.1 | Aquicella siphonis |
| 36 | 3359932 | 3360117 | - | NZ_LS483250.1 | Moritella yayanosii |
| 37 | 1799732 | 1799950 | - | NC_015559.1 | Marinomonas posidonica IVIA-Po-181 |
| 38 | 3462431 | 3462604 | - | NZ_CP031416.1 | Gallaecimonas mangrovi |
| 39 | 3076903 | 3077100 | + | NZ_CP034752.1 | Jinshanibacter zhutongyuii |
| 40 | 2174692 | 2174889 | - | NZ_CP023536.1 | Providencia alcalifaciens |
| 41 | 714341 | 714538 | - | NC_013166.1 | Kangiella koreensis DSM 16069 |
| 42 | 439009 | 439209 | - | NZ_CP040021.1 | Salinivibrio kushneri |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP038018.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00482.25 | 0.9 | 38 | 2327.0 | same-strand | Type II secretion system (T2SS), protein F |
| 2 | PF06750.15 | 0.9 | 38 | 1402.0 | same-strand | Bacterial Peptidase A24 N-terminal domain |
| 3 | PF01478.20 | 0.9 | 38 | 1402.0 | same-strand | Type IV leader peptidase family |
| 4 | PF01121.22 | 0.93 | 39 | 779 | same-strand | Dephospho-CoA kinase |
| 5 | PF00437.22 | 0.79 | 33 | 3646 | same-strand | Type II/IV secretion system protein |
| 6 | PF07072.13 | 0.64 | 27 | 18 | same-strand | Cell division protein |
++ More..