Result : Q9JRE9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0339 protein NMA1193/NMA1859 |
| NCBI Accession ID | AL157959.1 |
| Organism | Neisseria meningitidis serogroup A / serotype 4A (strain DSM 15465 / Z2491) |
| Left | 1135851 |
| Right | 1136021 |
| Strand | - |
| Nucleotide Sequence | ATGTATTTTGAAATCTATAAAGACGCAAAAGGCGAATACCGTTGGCGTTTGAAAGCAGCCAACCATGAAATCATCGCTCAGGGCGAAGGCTACACCAGCAAGCAAAACTGCCAGCACGCAGTCGATTTGCTGAAAAGCACTACCGCCGCTACCCCTGTAAAAGAGGTATAA |
| Sequence | MYFEIYKDAKGEYRWRLKAANHEIIAQGEGYTSKQNCQHAVDLLKSTTAATPVKEV |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01356. Profile Description: Domain of unknown function (DUF1508). This family represents a series of bacterial domains of unknown function of around 50 residues in length. Members of this family are often found as tandem repeats and in some cases represent the whole protein. All member proteins are described as being hypothetical. |
| Pubmed ID | 10761919 |
| Domain | CDD:412856 |
| Functional Category | Others |
| Uniprot ID | Q9JRE9 |
| ORF Length (Amino Acid) | 56 |
++ More..
| Conservation Analysis |
No. of Species: 29
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 692525 | 692695 | - | NZ_CP021520.1 | Neisseria meningitidis |
| 2 | 614655 | 614825 | - | NZ_CP021520.1 | Neisseria meningitidis |
| 3 | 1553508 | 1553681 | + | NZ_CP031252.1 | Neisseria elongata |
| 4 | 80102 | 80275 | + | NZ_CP038018.1 | Eikenella exigua |
| 5 | 1290824 | 1290994 | + | NZ_CP059569.1 | Kingella oralis |
| 6 | 227061 | 227249 | + | NZ_CP016604.1 | Otariodibacter oris |
| 7 | 314868 | 315050 | + | NZ_CP040863.1 | Rodentibacter heylii |
| 8 | 1603740 | 1603925 | - | NZ_CP061280.1 | Mannheimia bovis |
| 9 | 1040154 | 1040339 | + | NZ_CP006944.1 | Mannheimia varigena USDA-ARS-USMARC-1312 |
| 10 | 1795246 | 1795431 | + | NZ_CP029206.1 | Actinobacillus porcitonsillarum |
| 11 | 747626 | 747811 | + | NZ_CP030753.1 | Actinobacillus pleuropneumoniae |
| 12 | 1504485 | 1504664 | - | NZ_CP006954.1 | Bibersteinia trehalosi USDA-ARS-USMARC-188 |
| 13 | 829106 | 829288 | - | NZ_CP007715.1 | Actinobacillus equuli subsp. equuli |
| 14 | 778342 | 778524 | - | NZ_CP009159.1 | Actinobacillus suis ATCC 33415 |
| 15 | 1111564 | 1111749 | + | NZ_CP015029.1 | Frederiksenia canicola |
| 16 | 1355187 | 1355372 | - | NC_021883.1 | Mannheimia haemolytica USMARC_2286 |
| 17 | 645697 | 645867 | - | NC_011852.1 | Glaesserella parasuis SH0165 |
| 18 | 599131 | 599301 | - | NC_011852.1 | Glaesserella parasuis SH0165 |
| 19 | 655542 | 655712 | + | NZ_CP009610.1 | Haemophilus influenzae |
| 20 | 1435031 | 1435201 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 21 | 2247693 | 2247884 | + | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 22 | 1360551 | 1360721 | + | NZ_LS483429.1 | Haemophilus aegyptius |
| 23 | 1718734 | 1718907 | - | NZ_LR134510.1 | Actinobacillus delphinicola |
| 24 | 4374704 | 4374889 | + | NZ_CP003811.1 | Methylobacterium oryzae CBMB20 |
| 25 | 3766790 | 3766972 | + | NZ_CP024608.1 | Massilia violaceinigra |
| 26 | 3568526 | 3568711 | - | NZ_CP029553.1 | Methylobacterium terrae |
| 27 | 3511433 | 3511618 | + | NZ_CP015367.1 | Methylobacterium phyllosphaerae |
| 28 | 2644120 | 2644290 | + | NC_022997.1 | Hyphomicrobium nitrativorans NL23 |
| 29 | 4061961 | 4062146 | + | NC_010505.1 | Methylobacterium radiotolerans JCM 2831 |
| 30 | 1409468 | 1409641 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| 31 | 3932790 | 3932963 | + | NZ_CP013119.1 | Alcaligenes faecalis |
| 32 | 234709 | 234897 | - | NC_014298.1 | Halalkalicoccus jeotgali B3 |
++ More..