Protein Information |
Information Type | Description |
---|---|
Protein name | ATP synthase subunit c (ATP synthase F(0) sector subunit c) (F-type ATPase subunit c) (F-ATPase subunit c) (Lipid-binding protein) |
NCBI Accession ID | CP000896.1 |
Organism | Acholeplasma laidlawii (strain PG-8A) |
Left | 1010141 |
Right | 1010401 |
Strand | - |
Nucleotide Sequence | ATGAATACATTCTTTCAAATAATGACACAAACTGAATTTTTTGCTACAGGTTTAGCATACTTAGGCGCTGGTATTTCCATTTTGGCTGCTGGTTTAGCAGGTATTGGACAAGGGCTGGCTGCTGCACGTGCGGTTGAGGCTGTAGGCCGCCAACCAGAGGCAAGTGGTAAAATTACAGTGACCATGATTTTAGGTCAAGCGATGGTAGAAACTTCTGGTATTTATGCATTAATTATTGCATTTATATTATCAAGTAAGTAA |
Sequence | MNTFFQIMTQTEFFATGLAYLGAGISILAAGLAGIGQGLAAARAVEAVGRQPEASGKITVTMILGQAMVETSGIYALIIAFILSSK |
Source of smORF | Swiss-Prot |
Function | F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}. |
Pubmed ID | 21784942 |
Domain | CDD:412393 |
Functional Category | Others |
Uniprot ID | A9NGW7 |
ORF Length (Amino Acid) | 86 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1010141 | 1010401 | - | NC_010163.1 | Acholeplasma laidlawii PG-8A |
2 | 833223 | 833432 | + | NC_022549.1 | Acholeplasma brassicae |
3 | 2140523 | 2140732 | + | NZ_AP019711.1 | Amedibacterium intestinale |
4 | 695921 | 696136 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
5 | 205497 | 205766 | + | NC_018664.1 | Gottschalkia acidurici 9a |
6 | 2593559 | 2593822 | - | NZ_CP016379.1 | Anoxybacter fermentans |
7 | 1678831 | 1679115 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
8 | 147250 | 147486 | + | NZ_LR134523.1 | Peptoniphilus ivorii |
9 | 177150 | 177416 | + | NZ_LT635475.1 | Ezakiella massiliensis |
10 | 99226 | 99483 | - | NZ_CP028106.1 | Fusobacterium gonidiaformans ATCC 25563 |
11 | 495877 | 496116 | + | NZ_CP028107.1 | Fusobacterium necrophorum subsp. funduliforme |
12 | 935552 | 935812 | - | NC_016630.1 | Filifactor alocis ATCC 35896 |
13 | 249734 | 249982 | + | NC_016894.1 | Acetobacterium woodii DSM 1030 |
14 | 3749867 | 3750079 | - | NC_014393.1 | Clostridium cellulovorans 743B |
15 | 269192 | 269428 | + | NC_014921.1 | Mycoplasmopsis fermentans M64 |
16 | 3417701 | 3417967 | - | NZ_CP014176.1 | Clostridium argentinense |
17 | 472732 | 472947 | + | NZ_CP043998.1 | Clostridium diolis |
18 | 3022813 | 3023094 | + | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
19 | 687584 | 687799 | + | NC_020291.1 | Clostridium saccharoperbutylacetonicum N1-4(HMT) |
20 | 3266064 | 3266279 | - | NZ_CP030775.1 | Clostridium butyricum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00006.27 | 0.9 | 18 | 1310.5 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
2 | PF02874.25 | 0.95 | 19 | 1189 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
3 | PF00231.21 | 0.95 | 19 | 2641 | same-strand | ATP synthase |
4 | PF00306.29 | 0.95 | 19 | 1095 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
5 | PF00213.20 | 0.9 | 18 | 544.0 | same-strand | ATP synthase delta (OSCP) subunit |
6 | PF00430.20 | 0.95 | 19 | 46 | same-strand | ATP synthase B/B' CF(0) |
7 | PF00119.22 | 0.95 | 19 | 55 | same-strand | ATP synthase A chain |
8 | PF03899.17 | 0.65 | 13 | 810 | same-strand | ATP synthase I chain |