Result : Q9I740
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Immune protein Tsi6 |
| NCBI Accession ID | AE004091.2 |
| Organism | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Left | 113022 |
| Right | 113306 |
| Strand | - |
| Nucleotide Sequence | ATGACACCCATCGAATACATCGACCGCGCTCTGGCGCTGGTCGTCGACCGGCTGGCCCGCTATCCGGGATACGAGGTCCTGCTGTCTGCGGAAAAGCAATTGCAGTACATCAGGTCCGTCCTGCTCGACCGCAGCCTGGATCGTTCCGCACTGCACCGGTTGACCCTCGGCAGCATCGCCGTGAAGGAATTCGACGAAACCGACCCGGAACTCTCCAGGGCCCTCAAGGACGCCTACTACGTCGGTATACGCACTGGCCGCGGCCTGAAGGTCGATCTGCCCTGA |
| Sequence | MTPIEYIDRALALVVDRLARYPGYEVLLSAEKQLQYIRSVLLDRSLDRSALHRLTLGSIAVKEFDETDPELSRALKDAYYVGIRTGRGLKVDLP |
| Source of smORF | Swiss-Prot |
| Function | Immunity protein that plays a role in preventing early activation of toxin Tse6. {ECO:0000269|Pubmed:26456113}. |
| Pubmed ID | 10984043 26456113 |
| Domain | CDD:408442 |
| Functional Category | Others |
| Uniprot ID | Q9I740 |
| ORF Length (Amino Acid) | 94 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 113022 | 113306 | - | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 2 | 3324611 | 3324895 | - | NZ_AP022642.1 | Pseudomonas otitidis |
| 3 | 3328575 | 3328820 | - | NZ_AP022642.1 | Pseudomonas otitidis |
| 4 | 1063519 | 1063803 | - | NZ_CP056030.1 | Pseudomonas eucalypticola |
| 5 | 5825560 | 5825856 | - | NZ_CP068034.2 | Pseudomonas syringae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002516.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05954.13 | 0.75 | 3 | 2054.0 | opposite-strand | Phage tail baseplate hub (GPD) |
| 2 | PF04717.14 | 0.75 | 3 | 2054.0 | opposite-strand | Type VI secretion system/phage-baseplate injector OB domain |
| 3 | PF15538.8 | 1.0 | 4 | -3 | same-strand | Bacterial toxin 46 |
| 4 | PF05488.15 | 0.75 | 3 | 1192.5 | same-strand | PAAR motif |
| 5 | PF08786.13 | 0.75 | 3 | 1623.0 | same-strand | DcrB |
++ More..