Protein Information |
Information Type | Description |
---|---|
Protein name | Immune protein Tsi6 |
NCBI Accession ID | AE004091.2 |
Organism | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
Left | 113022 |
Right | 113306 |
Strand | - |
Nucleotide Sequence | ATGACACCCATCGAATACATCGACCGCGCTCTGGCGCTGGTCGTCGACCGGCTGGCCCGCTATCCGGGATACGAGGTCCTGCTGTCTGCGGAAAAGCAATTGCAGTACATCAGGTCCGTCCTGCTCGACCGCAGCCTGGATCGTTCCGCACTGCACCGGTTGACCCTCGGCAGCATCGCCGTGAAGGAATTCGACGAAACCGACCCGGAACTCTCCAGGGCCCTCAAGGACGCCTACTACGTCGGTATACGCACTGGCCGCGGCCTGAAGGTCGATCTGCCCTGA |
Sequence | MTPIEYIDRALALVVDRLARYPGYEVLLSAEKQLQYIRSVLLDRSLDRSALHRLTLGSIAVKEFDETDPELSRALKDAYYVGIRTGRGLKVDLP |
Source of smORF | Swiss-Prot |
Function | Immunity protein that plays a role in preventing early activation of toxin Tse6. {ECO:0000269|Pubmed:26456113}. |
Pubmed ID | 10984043 26456113 |
Domain | CDD:408442 |
Functional Category | Others |
Uniprot ID | Q9I740 |
ORF Length (Amino Acid) | 94 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 113022 | 113306 | - | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
2 | 3324611 | 3324895 | - | NZ_AP022642.1 | Pseudomonas otitidis |
3 | 3328575 | 3328820 | - | NZ_AP022642.1 | Pseudomonas otitidis |
4 | 1063519 | 1063803 | - | NZ_CP056030.1 | Pseudomonas eucalypticola |
5 | 5825560 | 5825856 | - | NZ_CP068034.2 | Pseudomonas syringae |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF05954.13 | 0.75 | 3 | 2054.0 | opposite-strand | Phage tail baseplate hub (GPD) |
2 | PF04717.14 | 0.75 | 3 | 2054.0 | opposite-strand | Type VI secretion system/phage-baseplate injector OB domain |
3 | PF15538.8 | 1.0 | 4 | -3 | same-strand | Bacterial toxin 46 |
4 | PF05488.15 | 0.75 | 3 | 1192.5 | same-strand | PAAR motif |
5 | PF08786.13 | 0.75 | 3 | 1623.0 | same-strand | DcrB |