| Protein name |
Type III secretion regulatory protein ExsE |
| NCBI Accession ID |
AE004091.2 |
| Organism |
Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Left |
1856308 |
| Right |
1856553 |
| Strand |
+ |
| Nucleotide Sequence |
ATGAAAATCGAATCGATTTCGCCGGTGCAGCCGTCCCAAGACGCTGGAGCCGAGGCGGTGGGGCATTTCGAGGGGCGTTCGGTGACCCGCGCGGCCGTTCGCGGCGAGGACCGTTCCAGCGTGGCCGGGCTGGCGCGCTGGCTGGCGCGCAACGTGGCTGGCGATCCGCGTAGTGAGCAGGCCTTGCAGCGTCTCGCCGACGGTGACGGCACGCCGCTGGAGGCGCGCACGGTCCGGCGCAGGTGA |
| Sequence |
MKIESISPVQPSQDAGAEAVGHFEGRSVTRAAVRGEDRSSVAGLARWLARNVAGDPRSEQALQRLADGDGTPLEARTVRRR |
| Source of smORF |
Swiss-Prot |
| Function |
Acts as a negative regulator of the type III secretion regulon (T3SS) expression (Pubmed:15911752). In the absence of inducing signals such as low Ca(2+) or host cell contact, the T3SS/injectisome is expressed at a low basal level and exists in a quiescent state due to ExsA sequestration by ExsD. ExsE binding to ExsC disrupts the complex between ExsC and ExsD, thereby allowing free ExsD to bind ExsA (Pubmed:15911752, Pubmed:15985546). Upon inducing signal, ExsE is secreted allowing ExsC to bind ExsD. In turn, ExsD cannot bind ExsA and prevent ExsA-mediated transcriptional activation of the type III secretion system (Pubmed:15911752, Pubmed:15985546). {ECO:0000269|Pubmed:15911752, ECO:0000269|Pubmed:15985546}. |
| Pubmed ID |
10984043
15911752
15985546
20536183
|
| Domain |
CDD:423424 |
| Functional Category |
Others |
| Uniprot ID |
Q9I322
|
| ORF Length (Amino Acid) |
81 |