Result : Q9I0D9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Immune protein Tsi2 (Anti-toxin protein Tsi2) |
| NCBI Accession ID | AE004091.2 |
| Organism | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Left | 3057376 |
| Right | 3057609 |
| Strand | + |
| Nucleotide Sequence | ATGAACCTGAAACCCCAGACCCTGATGGTGGCGATCCAGTGCGTCGCCGCGCGCACCCGCGAACTCGACGCGCAGTTGCAGAACGACGACCCGCAGAACGCCGCTGAACTCGAACAGTTGCTGGTCGGCTACGACCTCGCCGCCGACGACCTGAAGAACGCCTACGAGCAAGCCCTGGGCCAATACAGCGGCCTGCCGCCCTATGACCGGCTGATCGAAGAGCCGGCATCCTGA |
| Sequence | MNLKPQTLMVAIQCVAARTRELDAQLQNDDPQNAAELEQLLVGYDLAADDLKNAYEQALGQYSGLPPYDRLIEEPAS |
| Source of smORF | Swiss-Prot |
| Function | Immunity protein that plays a role in preventing early activation of toxin Tse2. Binds to a large surface of Tse2 and thereby occludes the active site to specifically inhibits Tse2. {ECO:0000269|Pubmed:22310046, ECO:0000269|Pubmed:22511866, ECO:0000269|Pubmed:26749446}. |
| Pubmed ID | 10984043 22310046 22511866 26749446 |
| Domain | CDD:212589 |
| Functional Category | Others |
| Uniprot ID | Q9I0D9 |
| ORF Length (Amino Acid) | 77 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3057376 | 3057609 | + | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 2 | 3823796 | 3824026 | - | NC_015572.1 | Methylomonas methanica MC09 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_002516.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF18648.3 | 1.0 | 2 | 9.5 | same-strand | Tse2 ADP-ribosyltransferase toxins |
++ More..