Result : Q9HVZ6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Cell division protein FtsL |
| NCBI Accession ID | AE004091.2 |
| Organism | Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) |
| Left | 4954340 |
| Right | 4954633 |
| Strand | - |
| Nucleotide Sequence | ATGAGCCGTCTCTTCGTCAAGCGCCTGCCTACCGGCAGCTTCCTCATGTTGCTGCTTTATATAGGTCTGCTGCTCTCGGCGATTGCCGTGGCCTACAGCACCTACTGGAACCGGCAACTGCTCAACTCGCTGTATTCCGAGCTGAGCGTGCGCGACAAGGCGCAGGCCGAGTGGGGCCGGTTGATTCTCGAGCAGAGCACCTGGACCGCCCATAGCCGCATCGAAAGCCTGGCGGTGGAACAGTTGCGCATGCGCGTTCCCGACCCGGCCGAGGTCAGGATGGTGGCGCCATGA |
| Sequence | MSRLFVKRLPTGSFLMLLLYIGLLLSAIAVAYSTYWNRQLLNSLYSELSVRDKAQAEWGRLILEQSTWTAHSRIESLAVEQLRMRVPDPAEVRMVAP |
| Source of smORF | Swiss-Prot |
| Function | Essential cell division protein. May link together the upstream cell division proteins, which are predominantly cytoplasmic, with the downstream cell division proteins, which are predominantly periplasmic. {ECO:0000255|HAMAP-Rule:MF_00910}. |
| Pubmed ID | 10984043 |
| Domain | CDD:416267 |
| Functional Category | Others |
| Uniprot ID | Q9HVZ6 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 55
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 4954340 | 4954633 | - | NC_002516.2 | Pseudomonas aeruginosa PAO1 |
| 2 | 5903270 | 5903563 | - | NZ_CP048833.1 | Pseudomonas multiresinivorans |
| 3 | 1323026 | 1323319 | + | NZ_AP022642.1 | Pseudomonas otitidis |
| 4 | 1302496 | 1302789 | + | NZ_CP014158.1 | Pseudomonas citronellolis |
| 5 | 4778263 | 4778556 | - | NZ_CP047698.1 | Pseudomonas knackmussii |
| 6 | 1077392 | 1077685 | + | NZ_AP014862.1 | Pseudomonas furukawaii |
| 7 | 4869026 | 4869319 | - | NZ_CP068034.2 | Pseudomonas syringae |
| 8 | 1035183 | 1035476 | + | NZ_CP043311.1 | Pseudomonas lalkuanensis |
| 9 | 4934059 | 4934352 | - | NZ_CP042804.1 | Pseudomonas amygdali pv. tabaci str. ATCC 11528 |
| 10 | 4984408 | 4984701 | - | NC_004578.1 | Pseudomonas syringae pv. tomato str. DC3000 |
| 11 | 4963175 | 4963468 | - | NZ_CP007039.1 | Pseudomonas cichorii JBC1 |
| 12 | 1538413 | 1538706 | + | NZ_CP049044.1 | Pseudomonas psychrophila |
| 13 | 2415604 | 2415897 | - | NZ_CP014262.1 | Pseudomonas corrugata |
| 14 | 957922 | 958215 | + | NZ_CP062158.2 | Pseudomonas lundensis |
| 15 | 920835 | 921128 | + | NZ_CP014870.1 | Pseudomonas silesiensis |
| 16 | 5405625 | 5405918 | + | NZ_CP048810.1 | Pseudomonas bijieensis |
| 17 | 5785328 | 5785621 | - | NZ_CP051487.1 | Pseudomonas umsongensis |
| 18 | 5048453 | 5048746 | + | NZ_CP005960.1 | Pseudomonas mandelii JR-1 |
| 19 | 5531886 | 5532179 | - | NZ_CP034725.1 | Pseudomonas brassicacearum |
| 20 | 5615552 | 5615845 | - | NZ_CP061079.1 | Pseudomonas chlororaphis |
| 21 | 1172160 | 1172453 | + | NZ_CP027756.1 | Pseudomonas synxantha |
| 22 | 5544615 | 5544908 | - | NZ_CP035088.1 | Pseudomonas viciae |
| 23 | 5654096 | 5654389 | - | NZ_LS999205.1 | Pseudomonas protegens CHA0 |
| 24 | 4804412 | 4804705 | - | NZ_CP067022.1 | Pseudomonas cannabina pv. alisalensis |
| 25 | 4808186 | 4808479 | - | NC_008027.1 | Pseudomonas entomophila L48 |
| 26 | 1208151 | 1208444 | + | NZ_CP070503.1 | Pseudomonas atacamensis |
| 27 | 1243966 | 1244259 | + | NZ_CP054205.1 | Pseudomonas rhodesiae |
| 28 | 1105325 | 1105618 | + | NZ_CP018420.1 | Pseudomonas veronii |
| 29 | 5216524 | 5216817 | - | NZ_CP029608.1 | Pseudomonas kribbensis |
| 30 | 1018047 | 1018340 | + | NZ_CP027723.1 | Pseudomonas orientalis |
| 31 | 204946 | 205239 | + | NZ_CP012676.1 | Pseudomonas versuta |
| 32 | 1046394 | 1046687 | + | NZ_CP023272.1 | Pseudomonas lurida |
| 33 | 831389 | 831682 | + | NZ_CP012400.2 | Pseudomonas yamanorum |
| 34 | 5384677 | 5384970 | - | NZ_CP056030.1 | Pseudomonas eucalypticola |
| 35 | 880455 | 880748 | - | NZ_CP014205.2 | Pseudomonas glycinae |
| 36 | 5424418 | 5424711 | - | NZ_CP062253.1 | Pseudomonas gozinkensis |
| 37 | 5442997 | 5443290 | - | NZ_CP062252.1 | Pseudomonas allokribbensis |
| 38 | 1022850 | 1023143 | + | NZ_CP010896.1 | Pseudomonas simiae |
| 39 | 1092881 | 1093174 | + | NZ_CP046621.1 | Pseudomonas alkylphenolica |
| 40 | 6144707 | 6145000 | + | NZ_CP009365.1 | Pseudomonas soli |
| 41 | 4675843 | 4676136 | - | NZ_CP024159.1 | Pseudomonas mosselii |
| 42 | 4002788 | 4003081 | - | NZ_CP013124.1 | Pseudomonas mendocina S5.2 |
| 43 | 3400782 | 3401075 | + | NZ_CP070505.1 | Pseudomonas toyotomiensis |
| 44 | 876984 | 877277 | + | NZ_CP009533.1 | Pseudomonas rhizosphaerae |
| 45 | 968650 | 968943 | + | NC_021505.1 | Pseudomonas putida NBRC 14164 |
| 46 | 2509664 | 2509957 | - | NZ_CP031146.1 | Pseudomonas plecoglossicida |
| 47 | 1049344 | 1049637 | + | NZ_CP068551.1 | Pseudomonas khazarica |
| 48 | 4174306 | 4174599 | - | NZ_CP060009.1 | Pseudomonas sediminis |
| 49 | 4862992 | 4863285 | - | NZ_CP022562.1 | Pseudomonas monteilii |
| 50 | 1161893 | 1162186 | + | NZ_CP011835.1 | Azotobacter chroococcum |
| 51 | 1169125 | 1169418 | + | NZ_LR215729.2 | Pseudomonas marincola |
| 52 | 1280456 | 1280749 | + | NC_012560.1 | Azotobacter vinelandii DJ |
| 53 | 1511981 | 1512274 | - | NZ_CP045302.1 | Azotobacter salinestris |
| 54 | 4773166 | 4773459 | - | NZ_CP071706.1 | Pseudomonas donghuensis |
| 55 | 1960609 | 1960878 | - | NZ_CP029822.1 | Entomomonas moraniae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP068034.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF08245.14 | 1.0 | 55 | 3195 | same-strand | Mur ligase middle domain |
| 2 | PF02875.23 | 1.0 | 55 | 3195 | same-strand | Mur ligase family, glutamate ligase domain |
| 3 | PF00953.23 | 1.0 | 55 | 4562 | same-strand | Glycosyl transferase family 4 |
| 4 | PF10555.11 | 1.0 | 55 | 4562 | same-strand | Phospho-N-acetylmuramoyl-pentapeptide-transferase signature 1 |
| 5 | PF01225.27 | 0.98 | 54 | 1742.0 | same-strand | Mur ligase family, catalytic domain |
| 6 | PF00905.24 | 1.0 | 55 | -3 | same-strand | Penicillin binding protein transpeptidase domain |
| 7 | PF03717.17 | 1.0 | 55 | -3 | same-strand | Penicillin-binding Protein dimerisation domain |
| 8 | PF01795.21 | 1.0 | 55 | -3 | same-strand | MraW methylase family |
| 9 | PF00590.22 | 0.98 | 54 | 2148.5 | same-strand | Tetrapyrrole (Corrin/Porphyrin) Methylases |
| 10 | PF04348.15 | 0.98 | 54 | 3239.5 | opposite-strand | LppC putative lipoprotein |
| 11 | PF02381.20 | 0.76 | 42 | 941.0 | same-strand | MraZ protein, putative antitoxin-like |
| 12 | PF02021.19 | 0.82 | 45 | 5087 | opposite-strand | Uncharacterised protein family UPF0102 |
++ More..