Protein Information |
Information Type | Description |
---|---|
Protein name | Hrp pili protein HrpA (TTSS pilin HrpA) |
NCBI Accession ID | |
Organism | Pantoea stewartii subsp. stewartii (Erwinia stewartii) |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MGLGGPLSSATSFASKTLEGAMSDSMAESAVAQAAKMKIDTQNSILDGKMDSATKEINSGHNAAKAIQF |
Source of smORF | Swiss-Prot |
Function | Major structure protein of the hrp pilus, which is a component of the type III secretion system (TTSS, Hrp secretion system) required for effector protein delivery, parasitism, and pathogenicity. The hrp pilus functions as a conduit for protein delivery into the host cell (By similarity). {ECO:0000250}. |
Pubmed ID | 11605961 |
Domain | |
Functional Category | Others |
Uniprot ID | Q9FCZ8 |
ORF Length (Amino Acid) | 69 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 297893 | 298102 | - | NZ_CP049116.1 | Pantoea stewartii |
2 | 604529 | 604732 | + | NZ_CP023567.1 | Erwinia pyrifoliae |
3 | 2534786 | 2534992 | - | NZ_CP038498.1 | Pectobacterium punjabense |
4 | 4165261 | 4165467 | - | NZ_CP047495.1 | Pectobacterium brasiliense |
5 | 2067002 | 2067208 | + | NZ_CP034036.1 | Brenneria nigrifluens DSM 30175 = ATCC 13028 |
6 | 2222169 | 2222375 | + | NZ_CP051652.1 | Pectobacterium carotovorum |
7 | 2731748 | 2731954 | - | NZ_CP009125.1 | Pectobacterium atrosepticum |
8 | 2632502 | 2632708 | - | NZ_CP065044.1 | Pectobacterium aroidearum |
9 | 2331792 | 2331998 | + | NZ_CP034938.1 | Pectobacterium odoriferum |
10 | 1396756 | 1396962 | - | NZ_CP017482.1 | Pectobacterium polaris |
11 | 1967369 | 1967575 | - | NZ_CP014137.1 | Brenneria goodwinii |
12 | 2166758 | 2166934 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
13 | 2603529 | 2603729 | - | NZ_CP031560.1 | Dickeya dianthicola |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF06266.14 | 0.77 | 10 | 2619.5 | same-strand | HrpF protein |
2 | PF06188.14 | 1.0 | 13 | 1878 | same-strand | HrpE/YscL/FliH and V-type ATPase subunit E |
3 | PF01514.19 | 1.0 | 13 | 446 | same-strand | Secretory protein of YscJ/FliF family |
4 | PF17001.7 | 1.0 | 13 | 69 | same-strand | Type III secretion basal body protein I, YscI, HrpB, PscI |
5 | PF00158.28 | 1.0 | 13 | 1986 | same-strand | Sigma-54 interaction domain |
6 | PF14532.8 | 1.0 | 13 | 1986 | same-strand | Sigma-54 interaction domain |
7 | PF07728.16 | 1.0 | 13 | 1986 | same-strand | AAA domain (dynein-related subfamily) |
8 | PF02954.21 | 1.0 | 13 | 1986 | same-strand | Bacterial regulatory protein, Fis family |
9 | PF00004.31 | 1.0 | 13 | 1986 | same-strand | ATPase family associated with various cellular activities (AAA) |
10 | PF00072.26 | 1.0 | 13 | 3410 | same-strand | Response regulator receiver domain |
11 | PF00196.21 | 1.0 | 13 | 3410 | same-strand | Bacterial regulatory proteins, luxR family |
12 | PF08448.12 | 1.0 | 13 | 4087 | same-strand | PAS fold |
13 | PF00989.27 | 1.0 | 13 | 4087 | same-strand | PAS fold |
14 | PF13426.9 | 1.0 | 13 | 4087 | same-strand | PAS domain |
15 | PF07730.15 | 1.0 | 13 | 4087 | same-strand | Histidine kinase |
16 | PF02518.28 | 1.0 | 13 | 4087 | same-strand | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
17 | PF04542.16 | 1.0 | 13 | 5798 | same-strand | Sigma-70 region 2 |
18 | PF08281.14 | 1.0 | 13 | 4036.5 | same-strand | Sigma-70, region 4 |
19 | PF04545.18 | 1.0 | 13 | 4961.5 | same-strand | Sigma-70, region 4 |