Result : Q9F5Y0

Protein Information

• Protein name: Protein RnfH
• NCBI Accession ID: AF302049.1
• Organism: Azotobacter vinelandii (strain DJ / ATCC BAA-1303)
• Left: 1031
• Right: 1291
• Strand: +
• Nucleotide Sequence: ATGAGAGTTTCCGTGGTATACGCCGATCCGGCCAAGCCCCTCCAGCTCAGTTGCAAGGTGGAGGACGGCTGCAGCGTGGAGCAAGCGATCCAGCAGTCCGGCGTACTGCGCTGCTGTCCGGACATCGACCTGAAGAAGCAGAAGGTCGGCGTGTTCGGCAAGTTCGTCAAGTTGGACAGTCCGCTCAAGGATGGCGACCGCATCGAGATCTACCAGCGCGTCACGCGGGTCGATGATGACGACGACGATGATGACGATTGA
• Sequence: MRVSVVYADPAKPLQLSCKVEDGCSVEQAIQQSGVLRCCPDIDLKKQKVGVFGKFVKLDSPLKDGDRIEIYQRVTRVDDDDDDDDD
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl28922. Profile Description: Beta-grasp ubiquitin-like fold. This domain is the binding/interacting region of several protein kinases, such as the Schizosaccharomyces pombe Byr2. Byr2 is a Ser/Thr-specific protein kinase acting as mediator of signals for sexual differentiation in S. pombe by initiating a MAPK module, which is a highly conserved element in eukaryotes. Byr2 is activated by interacting with Ras, which then translocates the molecule to the plasma membrane. Ras proteins are key elements in intracellular signaling and are involved in a variety of vital processes such as DNA transcription, growth control, and differentiation. They function like molecular switches cycling between GTP-bound 'on' and GDP-bound 'off' states.
• Pubmed ID: 19429624
• Domain: CDD:421700
• Functional Category: Others
• Uniprot ID: Q9F5Y0
• ORF Length (Amino Acid): 86

Conservation Analysis

No. of Species: 13

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	5162704	5162964	-	NC_012560.1	Azotobacter vinelandii DJ
2	4393550	4393813	-	NZ_CP011835.1	Azotobacter chroococcum
3	2874357	2874620	+	NZ_CP045302.1	Azotobacter salinestris
4	2508926	2509183	-	NZ_CP060084.1	Teredinibacter haidensis
5	1352720	1352992	+	NZ_CP064781.1	Azospira restricta
6	1849930	1850196	-	NC_006526.2	Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821
7	3584900	3585160	-	NZ_CP011412.1	Sedimenticola thiotaurini
8	123464	123739	+	NZ_CP039268.1	Thermochromatium tepidum ATCC 43061
9	936331	936612	-	NC_021291.1	Spiribacter salinus M19-40
10	2827633	2827857	-	NZ_CP070624.1	Photobacterium damselae subsp. damselae
11	650188	650451	+	NZ_AP014636.1	Vibrio tritonius
12	2283983	2284267	+	NC_016112.1	Methylotuvimicrobium alcaliphilum 20Z
13	1013534	1013800	+	NZ_CP009978.1	Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_012560.1

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF02508.16	0.69	9	13	same-strand	Rnf-Nqr subunit, membrane protein
2	PF04205.16	0.69	9	726	same-strand	FMN-binding domain
3	PF03116.17	0.69	9	1390	same-strand	NQR2, RnfD, RnfE family
4	PF01512.19	0.69	9	2472	same-strand	Respiratory-chain NADH dehydrogenase 51 Kd subunit
5	PF13375.8	0.69	9	2472	same-strand	RnfC Barrel sandwich hybrid domain
6	PF10531.11	0.69	9	2472	same-strand	SLBB domain
7	PF13237.8	0.69	9	2539	same-strand	4Fe-4S dicluster domain
8	PF13183.8	0.69	9	2472	same-strand	4Fe-4S dicluster domain
9	PF12838.9	0.69	9	2539	same-strand	4Fe-4S dicluster domain
10	PF13187.8	0.69	9	3202.5	same-strand	4Fe-4S dicluster domain
11	PF14697.8	0.69	9	3980	same-strand	4Fe-4S dicluster domain
12	PF00037.29	0.69	9	4046	same-strand	4Fe-4S binding domain
13	PF04060.15	0.69	9	4046	same-strand	Putative Fe-S cluster