Protein Information |
Information Type | Description |
---|---|
Protein name | Photosystem II reaction center X protein |
NCBI Accession ID | |
Organism | Thermosynechococcus elongatus (strain BP-1) |
Left | |
Right | |
Strand | |
Nucleotide Sequence | |
Sequence | MTITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL |
Source of smORF | Swiss-Prot |
Function | Involved in the binding and/or turnover of quinones at the Q(B) site of Photosystem II. PSII is a light-driven water plastoquinone oxidoreductase, using light energy to abstract electrons from H(2)O, generating a proton gradient subsequently used for ATP formation. {ECO:0000269|Pubmed:11230572, ECO:0000269|Pubmed:20558739, ECO:0000269|Pubmed:21367867, ECO:0000269|Pubmed:25006873}. |
Pubmed ID | 11230572 12240834 17935689 17967798 14764885 19219048 20558739 21367867 22665786 23413188 25043005 25006873 |
Domain | CDD:420068 |
Functional Category | Others |
Uniprot ID | Q9F1R6 |
ORF Length (Amino Acid) | 41 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 2100122 | 2100247 | + | NC_004113.1 | Thermosynechococcus vestitus BP-1 |
2 | 1975827 | 1975952 | + | NZ_AP018202.1 | Thermostichus vulcanus NIES-2134 |
3 | 2139386 | 2139508 | - | NZ_CP018092.1 | Synechococcus lividus PCC 6715 |
4 | 2109245 | 2109367 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
5 | 5586637 | 5586741 | + | NC_019695.1 | Chroococcidiopsis thermalis PCC 7203 |
6 | 5886 | 6005 | + | NC_019693.1 | Oscillatoria acuminata PCC 6304 |
7 | 2790002 | 2790121 | - | NC_019753.1 | Crinalium epipsammum PCC 9333 |
8 | 658491 | 658610 | + | NC_019780.1 | Dactylococcopsis salina PCC 8305 |
9 | 496875 | 496994 | + | NC_019771.1 | Anabaena cylindrica PCC 7122 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF07444.13 | 1.0 | 9 | 181 | same-strand | Ycf66 protein N-terminus |