Result : Q9EXU9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | PqqA binding protein (Coenzyme PQQ synthesis protein D) (Pyrroloquinoline quinone biosynthesis protein D) |
| NCBI Accession ID | AL591985.1 |
| Organism | Rhizobium meliloti (strain 1021) (Ensifer meliloti) (Sinorhizobium meliloti) |
| Left | 215504 |
| Right | 215800 |
| Strand | + |
| Nucleotide Sequence | ATGACGGCCGACGCGCCCGTGATTTCAGGATCGAGCGTCGTCAAGCTGGCACGAGGGGTCCGGCTGCATGAGGATCCGGTCCGCGGCCAGACAGTGCTGCTGGCTCCGGAGCGCGCCATGGCCGTGGACGACATCGCCGTCGCCATCGTTCAGGCTCTCGATGGCGAACGGAACCTCGACCGGATCGCCGCCGACTTTGCCGAGAAGTTCGACGCCCCCGTCGAAGAGATCGCCGAGGATGTCAGGACTTTCGTCCAGGAGCTCTCCGTCCGCCGCATGCTGGAGATCGTCCAATGA |
| Sequence | MTADAPVISGSSVVKLARGVRLHEDPVRGQTVLLAPERAMAVDDIAVAIVQALDGERNLDRIAADFAEKFDAPVEEIAEDVRTFVQELSVRRMLEIVQ |
| Source of smORF | Swiss-Prot |
| Function | Functions as a PqqA binding protein and presents PqqA to PqqE, in the pyrroloquinoline quinone (PQQ) biosynthetic pathway. {ECO:0000255|HAMAP-Rule:MF_00655}. |
| Pubmed ID | 11481431 11474104 |
| Domain | CDD:414309 |
| Functional Category | Others |
| Uniprot ID | Q9EXU9 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 11
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 215504 | 215800 | + | NC_020560.1 | Sinorhizobium meliloti 2011 |
| 2 | 1815917 | 1816213 | - | NZ_CP041241.1 | Ensifer mexicanus |
| 3 | 434182 | 434478 | + | NZ_CP013110.1 | Sinorhizobium americanum |
| 4 | 955989 | 956285 | + | NZ_CP029452.1 | Sinorhizobium fredii CCBAU 25509 |
| 5 | 453370 | 453609 | + | NZ_CP029452.1 | Sinorhizobium fredii CCBAU 25509 |
| 6 | 1005557 | 1005868 | + | NZ_CP034910.1 | Ensifer alkalisoli |
| 7 | 1853170 | 1853466 | - | NZ_CP023068.1 | Ensifer sojae CCBAU 05684 |
| 8 | 844899 | 845138 | - | NZ_CP032509.1 | Georhizobium profundi |
| 9 | 769379 | 769636 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| 10 | 245207 | 245482 | + | NZ_CP032125.1 | Profundibacter amoris |
| 11 | 3259610 | 3259903 | + | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 12 | 3516251 | 3516541 | - | NC_022041.1 | Paracoccus aminophilus JCM 7686 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP041241.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF12706.9 | 1.0 | 11 | 765.5 | same-strand | Beta-lactamase superfamily domain |
| 2 | PF03070.18 | 1.0 | 11 | -3.0 | same-strand | TENA/THI-4/PQQC family |
| 3 | PF04055.23 | 1.0 | 11 | -3.0 | same-strand | Radical SAM superfamily |
| 4 | PF13186.8 | 1.0 | 11 | -3.0 | same-strand | Iron-sulfur cluster-binding domain |
| 5 | PF08042.13 | 0.82 | 9 | 1743.5 | same-strand | PqqA family |
++ More..