Protein Information |
Information Type | Description |
---|---|
Protein name | Probable protein-export membrane protein SecG |
NCBI Accession ID | U00089.2 |
Organism | Mycoplasma pneumoniae (strain ATCC 29342 / M129) |
Left | 294140 |
Right | 294370 |
Strand | + |
Nucleotide Sequence | ATGGACGCAATTCAAATAGTAATGTTTGTAATGGCAATCCTTTGTTTAATCATCGGTTTATTGCTATCCAACCATGGTTCTACTGGCGGACTTGCTTCGCTTTCAGGTCAAGATTTGGAAATTTTTCGCAAAACCAAAGACCGCGGAATTGTCAAAATTCTCCAAATTACGATGTTTATTTTAGTAGTGCTTTTTCTTATTTTAGGGTTAGTTTTTCATTTTGCGCTTTAA |
Sequence | MDAIQIVMFVMAILCLIIGLLLSNHGSTGGLASLSGQDLEIFRKTKDRGIVKILQITMFILVVLFLILGLVFHFAL |
Source of smORF | Swiss-Prot |
Function | Involved in protein export. Participates in an early event of protein translocation (By similarity). {ECO:0000250}. |
Pubmed ID | 8948633 10954595 |
Domain | CDD:415590 |
Functional Category | Others |
Uniprot ID | Q9EXD0 |
ORF Length (Amino Acid) | 76 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 292511 | 292741 | + | NZ_CP010546.1 | Mycoplasma pneumoniae FH |
2 | 131149 | 131382 | + | NC_000908.2 | Mycoplasma genitalium G37 |
3 | 432923 | 433153 | + | NC_004432.1 | Mycoplasma penetrans HF-2 |
4 | 570701 | 570934 | - | NZ_CP059674.1 | Mycoplasma tullyi |
5 | 600980 | 601213 | - | NC_018406.1 | Mycoplasma gallisepticum VA94_7994-1-7P |
6 | 855570 | 855803 | + | NC_016638.1 | Mycoplasma haemocanis str. Illinois |
7 | 1082818 | 1083051 | + | NC_014970.1 | Mycoplasma haemofelis str. Langford 1 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF17876.3 | 1.0 | 7 | 297 | same-strand | Cold shock domain |