Protein Information |
Information Type | Description |
---|---|
Protein name | DNA-directed RNA polymerase subunit omega (RNAP omega subunit) (EC 2.7.7.6) (RNA polymerase omega subunit) (Transcriptase subunit omega) |
NCBI Accession ID | AJ295839.1 |
Organism | Thermus aquaticus |
Left | 1 |
Right | 300 |
Strand | + |
Nucleotide Sequence | ATGGCGGAACCGGGCATTGACAAGCTCTTCGGCATGGTGGACTCCAAGTACCGGCTCACGGTGGTGGTGGCCAAACGCGCCCAGCAGCTTCTGCGCCACCGCTTTAAGAACACGGTTCTGGAGCCGGAGGAGAGGCCCAAGATGCGCACCCTCGAGGGCCTCTACGACGACCCCAACGCCGTTACCTGGGCCATGAAGGAGCTTTTGACGGGGCGGCTTTTCTTCGGGGAGAACCTGGTGCCCGAGGACCGGCTTCAGAAGGAGATGGAAAGGCTCTACCCCACCGAAGAGGAGGCCTAG |
Sequence | MAEPGIDKLFGMVDSKYRLTVVVAKRAQQLLRHRFKNTVLEPEERPKMRTLEGLYDDPNAVTWAMKELLTGRLFFGENLVPEDRLQKEMERLYPTEEEA |
Source of smORF | Swiss-Prot |
Function | Promotes RNA polymerase assembly. Latches the N- and C-terminal regions of the beta' subunit thereby facilitating its interaction with the beta and alpha subunits. {ECO:0000269|Pubmed:11158566}. |
Pubmed ID | 11114902 11158566 |
Domain | CDD:417484 |
Functional Category | Others |
Uniprot ID | Q9EVV4 |
ORF Length (Amino Acid) | 99 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 358558 | 358857 | + | NZ_CP010822.1 | Thermus aquaticus Y51MC23 |
2 | 1485216 | 1485515 | - | NC_006461.1 | Thermus thermophilus HB8 |
3 | 513268 | 513567 | + | NZ_CP014141.1 | Thermus parvatiensis |
4 | 1368302 | 1368601 | + | NZ_CP016312.1 | Thermus brockianus |
5 | 1529201 | 1529500 | - | NZ_CP038452.1 | Thermus caldilimi |
6 | 588371 | 588673 | + | NC_019386.1 | Thermus oshimai JL-2 |
7 | 1634645 | 1634947 | - | NC_015387.1 | Marinithermus hydrothermalis DSM 14884 |
8 | 1305129 | 1305455 | + | NC_014212.1 | Meiothermus silvanus DSM 9946 |
9 | 1526642 | 1526944 | + | NC_014761.1 | Oceanithermus profundus DSM 14977 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00128.26 | 0.89 | 8 | 735.0 | opposite-strand | Alpha amylase, catalytic domain |
2 | PF00625.23 | 1.0 | 9 | -19 | same-strand | Guanylate kinase |
3 | PF04127.17 | 0.89 | 8 | 2.0 | same-strand | DNA / pantothenate metabolism flavoprotein |
4 | PF02441.21 | 0.89 | 8 | 2.0 | same-strand | Flavoprotein |
5 | PF01316.23 | 1.0 | 9 | 1202 | same-strand | Arginine repressor, DNA binding domain |
6 | PF02863.20 | 1.0 | 9 | 1202 | same-strand | Arginine repressor, C-terminal domain |
7 | PF01914.19 | 1.0 | 9 | 1696 | same-strand | MarC family integral membrane protein |