Result : Q9CP96
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein PM0157 |
| NCBI Accession ID | AE004439.1 |
| Organism | Pasteurella multocida (strain Pm70) |
| Left | 184704 |
| Right | 184913 |
| Strand | + |
| Nucleotide Sequence | ATGAAGAGAATATGGGTAAGTTTAATGATTGCTATAACAGCCTGTTCAGCGCACGCTAAGCGAGTAACTTGTAAGCATTTCGCTACGCAAGCTGAAGCACAAGCGTACATGGAAAAATATAAGGCTTATCATTTAGATGGCGATCATGATGGAGAAGCCTGTGAGTGTTTACTCGGTGGCAGTAGTCATGGTTTGGCACGCTGTCGGTGA |
| Sequence | MKRIWVSLMIAITACSAHAKRVTCKHFATQAEAQAYMEKYKAYHLDGDHDGEACECLLGGSSHGLARCR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl05460. Profile Description: Excalibur calcium-binding domain. Extracellular Ca2+-dependent nuclease YokF from Bacillus subtilis and several other surface-exposed proteins from diverse bacteria are encoded in the genomes in two paralogous forms that differ by a ~45 amino acid fragment, which comprises a novel conserved domain. Sequence analysis of this domain revealed a conserved DxDxDGxxCE motif, which is strikingly similar to the Ca2+-binding loop of the calmodulin-like EF-hand domains, suggesting an evolutionary relationship between them. Functions of many of the other proteins in which the novel domain, named Excalibur (extracellular calcium-binding region), is found, as well as a structural model of its conserved motif are consistent with the notion that the Excalibur domain binds calcium. This domain is but one more example of the diversity of structural contexts surrounding the EF-hand-like calcium-binding loop in bacteria. This loop is thus more widespread than hitherto recognised and the evolution of EF-hand-like domains is probably more complex than previously appreciated. |
| Pubmed ID | 11248100 |
| Domain | CDD:414425 |
| Functional Category | Others |
| Uniprot ID | Q9CP96 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1569402 | 1569611 | + | NZ_CP028926.1 | Pasteurella multocida |
| 2 | 1249467 | 1249670 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
| 3 | 1264794 | 1265006 | - | NZ_LT906448.1 | Pasteurella dagmatis |
| 4 | 685226 | 685432 | - | NZ_CP009238.1 | Basilea psittacipulmonis DSM 24701 |
++ More..