Result : Q9CN31
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein PM0614 |
| NCBI Accession ID | AE004439.1 |
| Organism | Pasteurella multocida (strain Pm70) |
| Left | 715173 |
| Right | 715451 |
| Strand | + |
| Nucleotide Sequence | ATGAAAACAGAATTAGAGCAAGAAAAAGAATTATTGATGATGAAAGGTGATGCATTGCGTATGAAACTTTATGCGCAATCTAAACCAAAACAAGTCACTCCCCATTTTACATTTGCAGATTCACTTTCAATGATTGCTTCTTCACTGAATCAACCCGTTGTGCGTTCGTTAGCCGTGTCATTACTCAGTAAAAAATTATTGAGTTCTAAATTTTTAACTTACTCTGCTTTAGGCATGATTGCGCTTTATTTATTGAATCGAAACAATTCAACGGAATAA |
| Sequence | MKTELEQEKELLMMKGDALRMKLYAQSKPKQVTPHFTFADSLSMIASSLNQPVVRSLAVSLLSKKLLSSKFLTYSALGMIALYLLNRNNSTE |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11248100 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9CN31 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2095255 | 2095533 | - | NZ_CP028926.1 | Pasteurella multocida |
| 2 | 781044 | 781322 | + | NZ_LT906448.1 | Pasteurella dagmatis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP028926.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF17432.4 | 1.0 | 2 | 5346.0 | opposite-strand | Domain of unknown function (DUF3458 C) ARM repeats |
| 2 | PF01433.22 | 1.0 | 2 | 5346.0 | opposite-strand | Peptidase family M1 domain |
| 3 | PF11940.10 | 1.0 | 2 | 5346.0 | opposite-strand | Domain of unknown function (DUF3458) Ig-like fold |
| 4 | PF17900.3 | 1.0 | 2 | 5346.0 | opposite-strand | Peptidase M1 N-terminal domain |
| 5 | PF01180.23 | 1.0 | 2 | 4163.5 | opposite-strand | Dihydroorotate dehydrogenase |
| 6 | PF01131.22 | 1.0 | 2 | 66.5 | opposite-strand | DNA topoisomerase |
| 7 | PF01751.24 | 1.0 | 2 | 66.5 | opposite-strand | Toprim domain |
| 8 | PF08272.13 | 1.0 | 2 | 66.5 | opposite-strand | Topoisomerase I zinc-ribbon-like |
| 9 | PF01396.21 | 1.0 | 2 | 66.5 | opposite-strand | Topoisomerase DNA binding C4 zinc finger |
| 10 | PF07332.13 | 1.0 | 2 | 5.0 | same-strand | Putative Actinobacterial Holin-X, holin superfamily III |
| 11 | PF19029.2 | 1.0 | 2 | 465.0 | same-strand | DUF883 C-terminal glycine zipper region |
| 12 | PF05957.15 | 1.0 | 2 | 465.0 | same-strand | DUF883 N-terminal domain |
| 13 | PF08411.12 | 1.0 | 2 | 1995.5 | same-strand | Exonuclease C-terminal |
| 14 | PF00929.26 | 1.0 | 2 | 1995.5 | same-strand | Exonuclease |
++ More..