Result : A9NEN9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 30S ribosomal protein S6 |
| NCBI Accession ID | CP000896.1 |
| Organism | Acholeplasma laidlawii (strain PG-8A) |
| Left | 185787 |
| Right | 186074 |
| Strand | + |
| Nucleotide Sequence | ATGAGAAAGTACGAATTAATGTACATCGCTAATCCACAATTAGACCCAGAAAAATTAAAAGGTCTTGTTGCTAACCTATCAAACGTAATCACATCAAACGGTGGTTCTGTTTTATCTTTAAAAGAAATCGGGTTAAAAGATTTAGCATACGAAATCAACAAACATAGAAAAGGTTACTATGTATGGATGTTGGTTGAAGCATCGCCAGAAGCGATTGCTGAATACAAACGTGTCGTTAATATTACTGAATCAGTGATTCGTAATATTGAAGTCAAAGAAGGCGAATAA |
| Sequence | MRKYELMYIANPQLDPEKLKGLVANLSNVITSNGGSVLSLKEIGLKDLAYEINKHRKGYYVWMLVEASPEAIAEYKRVVNITESVIRNIEVKEGE |
| Source of smORF | Swiss-Prot |
| Function | Binds together with S18 to 16S ribosomal RNA. {ECO:0000255|HAMAP-Rule:MF_00360}. |
| Pubmed ID | 21784942 |
| Domain | CDD:412366 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | A9NEN9 |
| ORF Length (Amino Acid) | 95 |
++ More..
| Conservation Analysis |
No. of Species: 7
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 185787 | 186074 | + | NC_010163.1 | Acholeplasma laidlawii PG-8A |
| 2 | 948437 | 948724 | - | NZ_LR215050.1 | Acholeplasma hippikon |
| 3 | 1374891 | 1375178 | - | NC_022538.1 | Acholeplasma palmae J233 |
| 4 | 345748 | 346035 | + | NC_022549.1 | Acholeplasma brassicae |
| 5 | 579134 | 579403 | + | NZ_LR215048.1 | Acholeplasma axanthum |
| 6 | 4646634 | 4646924 | - | NZ_CP006837.1 | Lysinibacillus varians |
| 7 | 95059 | 95349 | + | NZ_CP019980.1 | Lysinibacillus sphaericus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_010163.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02464.19 | 0.71 | 5 | 112 | same-strand | Competence-damaged protein |
| 2 | PF00436.27 | 1.0 | 7 | 4 | same-strand | Single-strand binding protein family |
| 3 | PF01084.22 | 1.0 | 7 | 465 | same-strand | Ribosomal protein S18 |
| 4 | PF03948.16 | 0.71 | 5 | 853 | same-strand | Ribosomal protein L9, C-terminal domain |
| 5 | PF01281.21 | 0.71 | 5 | 853 | same-strand | Ribosomal protein L9, N-terminal domain |
| 6 | PF01368.22 | 0.71 | 5 | 853 | same-strand | DHH family |
++ More..