Result : Q9CLV6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein PM1095 |
| NCBI Accession ID | AE004439.1 |
| Organism | Pasteurella multocida (strain Pm70) |
| Left | 1290275 |
| Right | 1290448 |
| Strand | - |
| Nucleotide Sequence | ATGTTTTCTTGGAAGAAAGTTCTCTTTAAAGGTGTGATAGCGGTATTGTCGCTCTTTGTCTTCGCTGTCGCGGTATTTTTTGTCGGTATGGCGCTGTTAACGCTTGATCCGAAAGACCGTTGTTTAGATTATGGTGGACGTTATGACGATGCAACAAAAATATGTGAAAAATGA |
| Sequence | MFSWKKVLFKGVIAVLSLFVFAVAVFFVGMALLTLDPKDRCLDYGGRYDDATKICEK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11248100 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9CLV6 |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 393770 | 393943 | - | NZ_CP028926.1 | Pasteurella multocida |
| 2 | 1311352 | 1311513 | - | NZ_LT906448.1 | Pasteurella dagmatis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP028926.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06196.14 | 1.0 | 2 | 3660.0 | same-strand | Protein of unknown function (DUF997) |
| 2 | PF02786.19 | 1.0 | 2 | 2235.5 | same-strand | Carbamoyl-phosphate synthase L chain, ATP binding domain |
| 3 | PF00289.24 | 1.0 | 2 | 2235.5 | same-strand | Biotin carboxylase, N-terminal domain |
| 4 | PF02785.21 | 1.0 | 2 | 2235.5 | same-strand | Biotin carboxylase C-terminal domain |
| 5 | PF02655.16 | 1.0 | 2 | 2235.5 | same-strand | ATP-grasp domain |
| 6 | PF02222.24 | 1.0 | 2 | 2235.5 | same-strand | ATP-grasp domain |
| 7 | PF00364.24 | 1.0 | 2 | 1671.5 | same-strand | Biotin-requiring enzyme |
| 8 | PF01220.21 | 1.0 | 2 | 1070.5 | same-strand | Dehydroquinase class II |
| 9 | PF00378.22 | 1.0 | 2 | 75.0 | same-strand | Enoyl-CoA hydratase/isomerase |
| 10 | PF10011.11 | 1.0 | 2 | 1041.5 | same-strand | Predicted membrane protein (DUF2254) |
| 11 | PF02091.17 | 1.0 | 2 | 2551.0 | opposite-strand | Glycyl-tRNA synthetase alpha subunit |
| 12 | PF13417.8 | 1.0 | 2 | 3764.0 | opposite-strand | Glutathione S-transferase, N-terminal domain |
| 13 | PF13409.8 | 1.0 | 2 | 3764.0 | opposite-strand | Glutathione S-transferase, N-terminal domain |
| 14 | PF02798.22 | 1.0 | 2 | 3764.0 | opposite-strand | Glutathione S-transferase, N-terminal domain |
++ More..