Result : Q9CLJ2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein PM1237 |
| NCBI Accession ID | AE004439.1 |
| Organism | Pasteurella multocida (strain Pm70) |
| Left | 1428913 |
| Right | 1429149 |
| Strand | - |
| Nucleotide Sequence | ATGAGTGAACAGCTAAAAATAAAAGCCATGCGTGCAGCAGGTGTGGGTTGTGTCTTAATGTTAATGATAATTGCCTTAGTGGTGTTTATGCTCCCAACGGGCATATTAATTGATTATTTAACGCTAGCGGGTTCTTGGGTCGGTGGTGGAACCACTTTTGGTATTTTAATGTTGGCAGCCTTACCCCCTCTGACAGGCGCTATTTTTTATTATTTTTGGAAATGGGTATTAAAGTAA |
| Sequence | MSEQLKIKAMRAAGVGCVLMLMIIALVVFMLPTGILIDYLTLAGSWVGGGTTFGILMLAALPPLTGAIFYYFWKWVLK |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11248100 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9CLJ2 |
| ORF Length (Amino Acid) | 78 |
++ More..
| Conservation Analysis |
No. of Species: 6
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 578737 | 578973 | - | NZ_CP028926.1 | Pasteurella multocida |
| 2 | 2220265 | 2220501 | + | NZ_LT906448.1 | Pasteurella dagmatis |
| 3 | 214865 | 215074 | + | NZ_LR134167.1 | Avibacterium volantium |
| 4 | 47235 | 47444 | - | NZ_LS483443.1 | Aggregatibacter segnis ATCC 33393 |
| 5 | 1063578 | 1063787 | - | NZ_LR134327.1 | Aggregatibacter aphrophilus ATCC 33389 |
| 6 | 307995 | 308228 | - | NZ_CP016605.1 | Bisgaardia hudsonensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP028926.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00265.20 | 1.0 | 6 | 2.5 | same-strand | Thymidine kinase |
| 2 | PF00814.27 | 1.0 | 6 | 37.5 | same-strand | tRNA N6-adenosine threonylcarbamoyltransferase |
| 3 | PF01165.22 | 1.0 | 6 | 1311.0 | opposite-strand | Ribosomal protein S21 |
| 4 | PF01807.22 | 1.0 | 6 | 1650.5 | opposite-strand | CHC2 zinc finger |
| 5 | PF08275.13 | 1.0 | 6 | 1650.5 | opposite-strand | DNA primase catalytic core, N-terminal domain |
| 6 | PF08278.13 | 1.0 | 6 | 1650.5 | opposite-strand | DNA primase DnaG DnaB-binding |
| 7 | PF13155.8 | 1.0 | 6 | 1650.5 | opposite-strand | Toprim-like |
| 8 | PF13662.8 | 1.0 | 6 | 1650.5 | opposite-strand | Toprim domain |
| 9 | PF10410.11 | 1.0 | 6 | 1650.5 | opposite-strand | DnaB-helicase binding domain of primase |
| 10 | PF01751.24 | 1.0 | 6 | 1650.5 | opposite-strand | Toprim domain |
| 11 | PF13362.8 | 1.0 | 6 | 1650.5 | opposite-strand | Toprim domain |
| 12 | PF04546.15 | 1.0 | 6 | 3486.5 | opposite-strand | Sigma-70, non-essential region |
| 13 | PF04539.18 | 1.0 | 6 | 3486.5 | opposite-strand | Sigma-70 region 3 |
| 14 | PF03979.16 | 1.0 | 6 | 3486.5 | opposite-strand | Sigma-70 factor, region 1.1 |
| 15 | PF04542.16 | 1.0 | 6 | 3486.5 | opposite-strand | Sigma-70 region 2 |
| 16 | PF04545.18 | 1.0 | 6 | 3486.5 | opposite-strand | Sigma-70, region 4 |
| 17 | PF00140.22 | 1.0 | 6 | 3486.5 | opposite-strand | Sigma-70 factor, region 1.2 |
++ More..