Result : Q9CLE2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein PM1295 |
| NCBI Accession ID | AE004439.1 |
| Organism | Pasteurella multocida (strain Pm70) |
| Left | 1490204 |
| Right | 1490461 |
| Strand | - |
| Nucleotide Sequence | TTGCTGTTCCATATTTACCACCTATCTCGTTTTACTACTGCTAATAAAATTAGCGGAAATTACGCTGCTTTTTGCGCTTCTTTAACTAAAGCTGAAACGCGATCTGATAAAGATGCACCTTTCTCTACCCAAGCATTAACACGGTCTAAGTCTAAACGTAAACGTTCAGCATTGCCTGTTGCTAATGGGTTGAAAAAGCCTACGCGCTCAATAAAGCGACCGTCACGTGGTGAACGGCTATCTGCGACAACGATTTGA |
| Sequence | MLFHIYHLSRFTTANKISGNYAAFCASLTKAETRSDKDAPFSTQALTRSKSKRKRSALPVANGLKKPTRSIKRPSRGERLSATTI |
| Source of smORF | Swiss-Prot |
| Function | |
| Pubmed ID | 11248100 |
| Domain | |
| Functional Category | Others |
| Uniprot ID | Q9CLE2 |
| ORF Length (Amino Acid) | 85 |
++ More..
| Conservation Analysis |
No. of Species: 3
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 783292 | 783549 | + | NZ_CP028926.1 | Pasteurella multocida |
| 2 | 22531 | 22809 | + | NZ_LR134167.1 | Avibacterium volantium |
| 3 | 967150 | 967374 | - | NZ_LT615367.1 | Dickeya aquatica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP028926.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01245.22 | 1.0 | 3 | 1363 | opposite-strand | Ribosomal protein L19 |
| 2 | PF01746.23 | 1.0 | 3 | 571 | opposite-strand | tRNA (Guanine-1)-methyltransferase |
| 3 | PF01782.20 | 1.0 | 3 | -11 | opposite-strand | RimM N-terminal domain |
| 4 | PF05239.18 | 1.0 | 3 | -11 | opposite-strand | PRC-barrel domain |
| 5 | PF00886.21 | 1.0 | 3 | -198 | opposite-strand | Ribosomal protein S16 |
| 6 | PF07662.15 | 0.67 | 2 | 2591.0 | same-strand | Na+ dependent nucleoside transporter C-terminus |
| 7 | PF01773.22 | 0.67 | 2 | 2591.0 | same-strand | Na+ dependent nucleoside transporter N-terminus |
| 8 | PF07670.16 | 0.67 | 2 | 2591.0 | same-strand | Nucleoside recognition |
++ More..