Result : Q9CHW2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Acylphosphatase (EC 3.6.1.7) (Acylphosphate phosphohydrolase) |
| NCBI Accession ID | AE005176.1 |
| Organism | Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) |
| Left | 596163 |
| Right | 596456 |
| Strand | - |
| Nucleotide Sequence | ATGTTCAAAGTAAAAATGATTGTTTCTGGGCGCGTTCAGGGTGTCGGATTTCGTTATTTTGTTATCATAAGTGCGCGTGAACTGGGCATTTTAGGGCGTGTTTGGAATAATGATGACGGTACAGTTGAAATTCTCGCGCAAACAGAGGACGAAAAAAAATTAGAAGAATTCACTGCCATTGTTCGTGGGGAAAAATCAAGTAAAGGACGTCTTTCACCCTTTGCTAAAGTCACTGATGTCAAATCAAGCCCTGCAAATTTCCCTGATTTCACAGACTTCAATATCAAATATTAG |
| Sequence | MFKVKMIVSGRVQGVGFRYFVIISARELGILGRVWNNDDGTVEILAQTEDEKKLEEFTAIVRGEKSSKGRLSPFAKVTDVKSSPANFPDFTDFNIKY |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00551. Profile Description: Acylphosphatase. acylphosphatase; Provisional |
| Pubmed ID | 11337471 |
| Domain | CDD:412440 |
| Functional Category | Others |
| Uniprot ID | Q9CHW2 |
| ORF Length (Amino Acid) | 97 |
++ More..
| Conservation Analysis |
No. of Species: 40
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 547524 | 547817 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 2 | 695909 | 696202 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 3 | 64202 | 64495 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 4 | 1729026 | 1729304 | + | NZ_CP039457.1 | Streptococcus pasteurianus |
| 5 | 338325 | 338603 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 6 | 1415420 | 1415698 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| 7 | 1186854 | 1187132 | - | NZ_CP043405.1 | Streptococcus ratti |
| 8 | 576486 | 576764 | - | NZ_CP031733.1 | Streptococcus chenjunshii |
| 9 | 859381 | 859656 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 10 | 1602806 | 1603084 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 11 | 415715 | 415993 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 12 | 3422 | 3700 | - | NZ_CP013237.1 | Streptococcus mutans |
| 13 | 331866 | 332144 | - | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 14 | 400391 | 400669 | - | NZ_CP025536.1 | Streptococcus pluranimalium |
| 15 | 43688 | 43966 | - | NZ_CP014699.1 | Streptococcus pantholopis |
| 16 | 300003 | 300281 | - | NZ_CP010450.1 | Streptococcus pyogenes |
| 17 | 2061998 | 2062276 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 18 | 427958 | 428236 | - | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 19 | 263521 | 263799 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 20 | 1620878 | 1621159 | + | NC_012924.1 | Streptococcus suis SC84 |
| 21 | 1537210 | 1537488 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 22 | 152520 | 152798 | + | NZ_LR134293.1 | Streptococcus canis |
| 23 | 1722119 | 1722397 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 24 | 1453286 | 1453570 | + | NZ_LT906439.1 | Streptococcus merionis |
| 25 | 477727 | 478005 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 26 | 1392931 | 1393209 | + | NZ_CP034543.1 | Streptococcus periodonticum |
| 27 | 1390460 | 1390738 | + | NZ_LS483436.1 | Streptococcus intermedius |
| 28 | 859262 | 859546 | - | NZ_CP022680.1 | Streptococcus respiraculi |
| 29 | 1589090 | 1589371 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 30 | 276340 | 276618 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 31 | 227184 | 227462 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 32 | 555423 | 555701 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 33 | 1525838 | 1526116 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 34 | 1452466 | 1452744 | + | NZ_CP012805.1 | Streptococcus anginosus |
| 35 | 1918816 | 1919094 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 36 | 232787 | 233056 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 37 | 90021 | 90299 | + | NZ_CP016953.1 | Streptococcus himalayensis |
| 38 | 1474823 | 1475086 | + | NZ_LS483343.1 | Streptococcus ferus |
| 39 | 1465805 | 1466083 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 40 | 1107091 | 1107369 | - | NZ_CP032620.1 | Streptococcus koreensis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP054015.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00588.21 | 1.0 | 40 | 79.0 | opposite-strand | SpoU rRNA Methylase family |
| 2 | PF08032.14 | 1.0 | 40 | 79.0 | opposite-strand | RNA 2'-O ribose methyltransferase substrate binding |
| 3 | PF02096.22 | 0.9 | 36 | 83.0 | same-strand | 60Kd inner membrane protein |
| 4 | PF03449.17 | 0.75 | 30 | 1332.5 | opposite-strand | Transcription elongation factor, N-terminal |
| 5 | PF01272.21 | 0.75 | 30 | 1332.5 | opposite-strand | Transcription elongation factor, GreA/GreB, C-term |
| 6 | PF02618.18 | 0.7 | 28 | 1905.0 | opposite-strand | YceG-like family |
| 7 | PF01027.22 | 0.85 | 34 | 1372.5 | opposite-strand | Inhibitor of apoptosis-promoting Bax1 |
++ More..