Result : Q9CH83
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Exodeoxyribonuclease 7 small subunit (EC 3.1.11.6) (Exodeoxyribonuclease VII small subunit) (Exonuclease VII small subunit) |
| NCBI Accession ID | AE005176.1 |
| Organism | Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) |
| Left | 879134 |
| Right | 879373 |
| Strand | + |
| Nucleotide Sequence | ATGGCAACCAAAAAAGAAGATGTAAAATTTGAAGATAATTTGGCAGAGTTAGAAAATATTGTTCGTAAGTTGGAATCTGGTGATGTAGCATTGGAAGATGCTATTGCTGAATTTCAAAAAGGAATGAAAATTTCGGAAACCTTGAAAAAAACACTCAATGAAGCGGAAGAAACATTAGTAAAAATAGTTGGAAAAAATGATCAGGAGAGTGATTTCTCTCCGGAACAGAAAGACTATTAA |
| Sequence | MATKKEDVKFEDNLAELENIVRKLESGDVALEDAIAEFQKGMKISETLKKTLNEAEETLVKIVGKNDQESDFSPEQKDY |
| Source of smORF | Swiss-Prot |
| Function | Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. {ECO:0000250}. |
| Pubmed ID | 11337471 |
| Domain | CDD:412547 |
| Functional Category | Others |
| Uniprot ID | Q9CH83 |
| ORF Length (Amino Acid) | 79 |
++ More..
| Conservation Analysis |
No. of Species: 46
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 848445 | 848684 | + | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 2 | 927905 | 928141 | + | NZ_CP070872.1 | Lactococcus taiwanensis |
| 3 | 1140234 | 1140473 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 4 | 1737807 | 1738031 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 5 | 1933406 | 1933618 | - | NZ_CP022680.1 | Streptococcus respiraculi |
| 6 | 1329241 | 1329468 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 7 | 1401216 | 1401443 | - | NZ_CP017195.1 | Lactococcus paracarnosus |
| 8 | 2256545 | 2256757 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 9 | 187884 | 188096 | - | NZ_CP015196.1 | Streptococcus marmotae |
| 10 | 1410966 | 1411178 | - | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 11 | 261197 | 261415 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 12 | 956655 | 956867 | - | NZ_CP032621.1 | Streptococcus gwangjuense |
| 13 | 1113848 | 1114060 | - | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 14 | 1118995 | 1119210 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 15 | 463862 | 464077 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 16 | 1084583 | 1084795 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 17 | 67327 | 67545 | + | NZ_LT906439.1 | Streptococcus merionis |
| 18 | 494963 | 495184 | + | NZ_CP061835.1 | Weissella viridescens |
| 19 | 8852 | 9064 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 20 | 715716 | 715928 | + | NZ_LR594049.1 | Streptococcus gordonii |
| 21 | 1352922 | 1353134 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 22 | 1412472 | 1412684 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 23 | 604320 | 604538 | + | NZ_CP027563.1 | Weissella confusa |
| 24 | 712449 | 712694 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 25 | 501958 | 502173 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| 26 | 515686 | 515901 | + | NZ_LS483343.1 | Streptococcus ferus |
| 27 | 731344 | 731589 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 28 | 725140 | 725385 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 29 | 639808 | 640032 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 30 | 1236834 | 1237031 | - | NZ_CP017326.1 | Weissella soli |
| 31 | 2273948 | 2274178 | + | NZ_CP037940.1 | Weissella cryptocerci |
| 32 | 1000662 | 1000904 | - | NZ_CP029476.1 | Lactobacillus apis |
| 33 | 1258165 | 1258419 | + | NZ_CP040586.1 | Furfurilactobacillus rossiae |
| 34 | 1387736 | 1387939 | - | NZ_CP049366.1 | Companilactobacillus pabuli |
| 35 | 988195 | 988398 | + | NZ_CP040736.1 | Companilactobacillus futsaii |
| 36 | 184896 | 185111 | - | NZ_CP043405.1 | Streptococcus ratti |
| 37 | 1556789 | 1557010 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 38 | 865197 | 865433 | + | NZ_CP053421.1 | Pediococcus acidilactici |
| 39 | 1086064 | 1086267 | + | NZ_CP017702.1 | Companilactobacillus farciminis KCTC 3681 = DSM 20184 |
| 40 | 1546976 | 1547194 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 41 | 1485981 | 1486202 | + | NZ_CP027783.1 | Tetragenococcus osmophilus |
| 42 | 843961 | 844200 | + | NZ_CP017996.1 | Companilactobacillus crustorum |
| 43 | 280602 | 280820 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 44 | 681097 | 681336 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
| 45 | 1252881 | 1253120 | - | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 46 | 882855 | 883082 | + | NZ_CP047141.1 | Ligilactobacillus animalis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP070872.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02882.21 | 0.67 | 31 | 1343 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, NAD(P)-binding domain |
| 2 | PF00763.25 | 0.67 | 31 | 1343 | same-strand | Tetrahydrofolate dehydrogenase/cyclohydrolase, catalytic domain |
| 3 | PF02601.17 | 1.0 | 46 | -10.0 | same-strand | Exonuclease VII, large subunit |
| 4 | PF13742.8 | 1.0 | 46 | -10.0 | same-strand | OB-fold nucleic acid binding domain |
| 5 | PF01336.27 | 1.0 | 46 | -10.0 | same-strand | OB-fold nucleic acid binding domain |
| 6 | PF00348.19 | 0.83 | 38 | -3.0 | same-strand | Polyprenyl synthetase |
| 7 | PF02463.21 | 0.93 | 43 | 2142.0 | same-strand | RecF/RecN/SMC N terminal domain |
| 8 | PF01728.21 | 0.93 | 43 | 865 | same-strand | FtsJ-like methyltransferase |
| 9 | PF01316.23 | 0.74 | 34 | 1673.0 | same-strand | Arginine repressor, DNA binding domain |
| 10 | PF02863.20 | 0.67 | 31 | 1673 | same-strand | Arginine repressor, C-terminal domain |
| 11 | PF13476.8 | 0.87 | 40 | 2112.5 | same-strand | AAA domain |
++ More..