ProsmORF-pred
Result : Q9CGW5
Protein Information
Information Type Description
Protein name Glutaredoxin-like protein NrdH
NCBI Accession ID
Organism Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis)
Left
Right
Strand
Nucleotide Sequence
Sequence MVTVYSKNNCMQCKMVKKWLSEHEIAFDEINIDEQPEFVEKVIEMGFRAAPVITKDDFAFSGFRPSELAKLA
Source of smORF Swiss-Prot
Function Electron transport system for the ribonucleotide reductase system NrdEF.
Pubmed ID 11337471
Domain CDD:412351
Functional Category Others
Uniprot ID Q9CGW5
ORF Length (Amino Acid) 72
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 81
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 1003862 1004080 - NC_022369.1 Lactococcus lactis subsp. cremoris KW2
2 979777 979995 + NZ_CP032627.1 Lactococcus allomyrinae
3 213096 213323 + NZ_CP032627.1 Lactococcus allomyrinae
4 1037368 1037586 - NZ_CP070872.1 Lactococcus taiwanensis
5 1622719 1622937 + NZ_CP065637.1 Lactococcus garvieae
6 1031409 1031627 - NZ_CP017194.1 Lactococcus carnosus
7 2088682 2088900 + NZ_CP023392.1 Lactococcus raffinolactis
8 1083101 1083319 - NZ_CP017195.1 Lactococcus paracarnosus
9 685191 685409 - NZ_AP018400.1 Streptococcus ruminantium
10 841922 842140 - NZ_LR134336.1 Streptococcus oralis ATCC 35037
11 938093 938311 + NZ_CP032621.1 Streptococcus gwangjuense
12 1414796 1415014 + NZ_LR594046.1 Streptococcus dysgalactiae
13 1255527 1255745 - NZ_CP016953.1 Streptococcus himalayensis
14 1463698 1463922 - NZ_CP015196.1 Streptococcus marmotae
15 1888379 1888597 + NZ_CP032620.1 Streptococcus koreensis
16 1088826 1089044 + NC_015875.1 Streptococcus pseudopneumoniae IS7493
17 890328 890552 - NZ_CP022680.1 Streptococcus respiraculi
18 1601612 1601794 - NZ_CP018906.1 Lentilactobacillus curieae
19 684019 684237 - NZ_LS483436.1 Streptococcus intermedius
20 1224441 1224659 + NZ_CP065061.1 Streptococcus equi subsp. zooepidemicus
21 1305328 1305546 - NZ_LR134293.1 Streptococcus canis
22 1593023 1593241 + NZ_LR594049.1 Streptococcus gordonii
23 1077221 1077439 + NZ_CP010450.1 Streptococcus pyogenes
24 1152830 1153048 + NC_012924.1 Streptococcus suis SC84
25 987012 987188 + NZ_CP013237.1 Streptococcus mutans
26 1470235 1470411 + NZ_AP014612.1 Streptococcus troglodytae
27 1989674 1989856 + NZ_CP047121.1 Lentilactobacillus hilgardii
28 1301413 1301631 + NZ_CP034543.1 Streptococcus periodonticum
29 1316234 1316452 + NZ_CP012805.1 Streptococcus anginosus
30 2260582 2260761 + NC_020207.1 Enterococcus faecium ATCC 8459 = NRRL B-2354
31 1026549 1026728 + NZ_CP032626.1 Apilactobacillus bombintestini
32 390313 390534 - NZ_CP044534.1 Limosilactobacillus frumenti
33 807515 807691 - NZ_CP031733.1 Streptococcus chenjunshii
34 826243 826419 - NZ_LR134512.1 Streptococcus agalactiae
35 2313939 2314118 + NZ_CP065211.1 Enterococcus lactis
36 591448 591666 - NZ_LR594050.1 Streptococcus porcinus
37 1355169 1355387 + NZ_LS483383.1 Streptococcus cristatus ATCC 51100
38 101329 101505 + NZ_CP043405.1 Streptococcus ratti
39 1371129 1371305 + NZ_CP014699.1 Streptococcus pantholopis
40 2060578 2060760 - NZ_CP018796.1 Lentilactobacillus parabuchneri
41 738552 738731 - NC_020995.1 Enterococcus casseliflavus EC20
42 569884 570060 - NZ_CP025536.1 Streptococcus pluranimalium
43 665221 665439 + NZ_LR134341.1 Streptococcus pseudoporcinus
44 175418 175594 - NZ_CP014835.1 Streptococcus halotolerans
45 371341 371562 - NZ_CP045605.1 Limosilactobacillus reuteri
46 770188 770406 + NZ_LT906439.1 Streptococcus merionis
47 367740 367970 - NZ_CP045240.1 Limosilactobacillus vaginalis
48 370698 370880 + NZ_CP012033.1 Levilactobacillus koreensis
49 496844 497026 - NC_016605.1 Pediococcus claussenii ATCC BAA-344
50 193638 193817 + NZ_CP023011.2 Enterococcus hirae
51 390797 391018 - NZ_CP045530.1 Limosilactobacillus pontis
52 2352636 2352818 + NZ_CP029971.1 Lentilactobacillus kefiri
53 1242096 1242272 + NC_017581.1 Streptococcus thermophilus JIM 8232
54 2563446 2563622 + NZ_CP018061.1 Enterococcus mundtii
55 2180853 2181035 - NZ_CP014912.1 Secundilactobacillus paracollinoides
56 1455692 1455874 + NZ_LN898144.1 Paucilactobacillus oligofermentans DSM 15707 = LMG 22743
57 1181183 1181359 + NZ_LR134275.1 Streptococcus vestibularis
58 692927 693109 - NZ_LS483405.1 Levilactobacillus brevis
59 621651 621827 - NZ_CP039457.1 Streptococcus pasteurianus
60 3476963 3477142 - NZ_CP021874.1 Enterococcus wangshanyuanii
61 654806 654982 - NZ_CP029491.1 Streptococcus sobrinus
62 160522 160701 - NZ_CP027783.1 Tetragenococcus osmophilus
63 774531 774710 + NZ_CP012047.1 Tetragenococcus halophilus
64 1331566 1331748 - NZ_CP059603.1 Levilactobacillus suantsaii
65 566449 566625 - NZ_LS483343.1 Streptococcus ferus
66 2300224 2300403 + NZ_CP023074.1 Enterococcus thailandicus
67 1518001 1518177 - NZ_CP054015.1 Streptococcus gallolyticus
68 731609 731791 - NZ_CP032757.1 Lactiplantibacillus pentosus
69 1706231 1706413 + NZ_AP014680.1 Paucilactobacillus hokkaidonensis JCM 18461
70 223056 223238 - NZ_CP030105.1 Lactiplantibacillus plantarum
71 1629075 1629257 + NZ_CP053421.1 Pediococcus acidilactici
72 568346 568522 - NZ_LS483403.1 Streptococcus lutetiensis
73 756482 756679 + NZ_CP029684.2 Oenococcus sicerae
74 695829 696005 - NZ_LS483306.1 Enterococcus cecorum
75 1022144 1022323 + NZ_CP037940.1 Weissella cryptocerci
76 119629 119826 + NZ_CP014324.1 Oenococcus oeni
77 1093982 1094203 - NZ_CP014164.1 Aerococcus viridans
78 2131927 2132106 + NZ_CP040586.1 Furfurilactobacillus rossiae
79 448373 448564 - NZ_CP045563.1 Fructilactobacillus sanfranciscensis
80 1116052 1116273 + NZ_CP013988.1 Aerococcus urinaeequi
81 201263 201445 + NZ_CP015247.1 Leuconostoc suionicum
82 1487815 1487997 - NZ_CP028251.1 Leuconostoc mesenteroides
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_022369.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF00268.23 0.96 78 2413.0 same-strand Ribonucleotide reductase, small chain
2 PF02867.17 0.98 79 100 same-strand Ribonucleotide reductase, barrel domain
3 PF08343.12 0.98 79 100 same-strand Ribonucleotide reductase N-terminal
4 PF00317.23 0.98 79 100 same-strand Ribonucleotide reductase, all-alpha domain
++ More..