Protein Information |
Information Type | Description |
---|---|
Protein name | D-alanyl carrier protein (DCP) (D-alanine--poly(phosphoribitol) ligase subunit 2) |
NCBI Accession ID | AE005176.1 |
Organism | Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) |
Left | 1290260 |
Right | 1290499 |
Strand | - |
Nucleotide Sequence | ATGAAAGAACAAATTTTTGATATTATCGAAACCGTATCAGGCACAGACGAATTCCGTGAAGACTTAGACATGGATTTATTTGAAGAAGGAATTCTTGATTCAATGAGAGCCATCATGCTCATTGTTGAATTAGAAGGCGCTTTTGATATCAGTCTTCCACCATCAGAAATGGACCGTGAAGATTGGAATACAGCAAATAAAATAGCAGCACGCGTTCAGGAAAAAAAGGATGAAAATTAA |
Sequence | MKEQIFDIIETVSGTDEFREDLDMDLFEEGILDSMRAIMLIVELEGAFDISLPPSEMDREDWNTANKIAARVQEKKDEN |
Source of smORF | Swiss-Prot |
Function | Carrier protein involved in the D-alanylation of lipoteichoic acid (LTA). The loading of thioester-linked D-alanine onto DltC is catalyzed by D-alanine--D-alanyl carrier protein ligase DltA. The DltC-carried D-alanyl group is further transferred to cell membrane phosphatidylglycerol (PG) by forming an ester bond, probably catalyzed by DltD. D-alanylation of LTA plays an important role in modulating the properties of the cell wall in Gram-positive bacteria, influencing the net charge of the cell wall. {ECO:0000255|HAMAP-Rule:MF_00565}. |
Pubmed ID | 11337471 |
Domain | CDD:415812 |
Functional Category | Others |
Uniprot ID | Q9CG51 |
ORF Length (Amino Acid) | 79 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 1269715 | 1269954 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
2 | 876491 | 876730 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
3 | 1229532 | 1229771 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
4 | 1334983 | 1335225 | - | NZ_CP065637.1 | Lactococcus garvieae |
5 | 2753207 | 2753440 | - | NZ_CP023011.2 | Enterococcus hirae |
6 | 872908 | 873144 | + | NZ_AP022822.1 | Enterococcus saigonensis |
7 | 1987976 | 1988209 | - | NC_020207.1 | Enterococcus faecium ATCC 8459 = NRRL B-2354 |
8 | 2045677 | 2045910 | - | NZ_CP065211.1 | Enterococcus lactis |
9 | 1164152 | 1164361 | - | NZ_CP012034.1 | Companilactobacillus ginsenosidimutans |
10 | 624148 | 624342 | + | NC_012924.1 | Streptococcus suis SC84 |
11 | 1400608 | 1400802 | - | NZ_AP018400.1 | Streptococcus ruminantium |
12 | 247814 | 248008 | + | NZ_CP029491.1 | Streptococcus sobrinus |
13 | 1927072 | 1927296 | + | NZ_CP024699.1 | Fusobacterium pseudoperiodonticum |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF04914.14 | 1.0 | 13 | -7 | same-strand | DltD protein |
2 | PF00501.30 | 1.0 | 13 | 1255 | same-strand | AMP-binding enzyme |
3 | PF13193.8 | 1.0 | 13 | 1255 | same-strand | AMP-binding enzyme C-terminal domain |