Result : Q9CDX0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | AE005176.1 |
| Organism | Lactococcus lactis subsp. lactis (strain IL1403) (Streptococcus lactis) |
| Left | 2165439 |
| Right | 2165648 |
| Strand | - |
| Nucleotide Sequence | ATGAAATTGAGCGAAACTAAATCACTTCTTAAAGATTTGCGCGCTTTGTCAGTTGAAGAATTGACAACTCGTGAAGCTGAATTGAAGAAAGAATTGTTTGATCTTCGTTTCCAAGCTGCTGCTGGTCGTCTCGAAAACACAGCTAAGCTTGATGAAGTCAAGAAAACTATTGCACGTGTAAAAACTGTGCAAGCTGAATTGAACAAATAA |
| Sequence | MKLSETKSLLKDLRALSVEELTTREAELKKELFDLRFQAAAGRLENTAKLDEVKKTIARVKTVQAELNK |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | 11337471 |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q9CDX0 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 296
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2222174 | 2222383 | - | NC_022369.1 | Lactococcus lactis subsp. cremoris KW2 |
| 2 | 37492 | 37701 | - | NZ_CP070872.1 | Lactococcus taiwanensis |
| 3 | 1885914 | 1886123 | - | NZ_CP032627.1 | Lactococcus allomyrinae |
| 4 | 155212 | 155421 | - | NZ_CP065637.1 | Lactococcus garvieae |
| 5 | 1949648 | 1949854 | - | NZ_CP017194.1 | Lactococcus carnosus |
| 6 | 226245 | 226451 | + | NZ_CP017195.1 | Lactococcus paracarnosus |
| 7 | 857217 | 857423 | - | NZ_CP023392.1 | Lactococcus raffinolactis |
| 8 | 68957 | 69163 | + | NZ_CP010450.1 | Streptococcus pyogenes |
| 9 | 80665 | 80871 | + | NZ_LR134512.1 | Streptococcus agalactiae |
| 10 | 493436 | 493642 | + | NZ_CP022680.1 | Streptococcus respiraculi |
| 11 | 847315 | 847521 | + | NZ_CP015196.1 | Streptococcus marmotae |
| 12 | 77991 | 78197 | + | NZ_AP018400.1 | Streptococcus ruminantium |
| 13 | 1912576 | 1912785 | - | NZ_AP014612.1 | Streptococcus troglodytae |
| 14 | 111083 | 111289 | + | NZ_CP025536.1 | Streptococcus pluranimalium |
| 15 | 1484198 | 1484404 | - | NZ_CP014835.1 | Streptococcus halotolerans |
| 16 | 1753011 | 1753220 | + | NZ_CP013237.1 | Streptococcus mutans |
| 17 | 95671 | 95877 | + | NZ_CP029491.1 | Streptococcus sobrinus |
| 18 | 1714949 | 1715155 | - | NZ_CP034543.1 | Streptococcus periodonticum |
| 19 | 2034102 | 2034308 | - | NZ_LR594049.1 | Streptococcus gordonii |
| 20 | 1832749 | 1832955 | - | NZ_LT906439.1 | Streptococcus merionis |
| 21 | 66632 | 66838 | + | NZ_LS483403.1 | Streptococcus lutetiensis |
| 22 | 672597 | 672803 | + | NZ_CP043405.1 | Streptococcus ratti |
| 23 | 75717 | 75923 | + | NZ_CP039457.1 | Streptococcus pasteurianus |
| 24 | 874310 | 874516 | + | NZ_CP054015.1 | Streptococcus gallolyticus |
| 25 | 109804 | 110010 | + | NZ_LS483343.1 | Streptococcus ferus |
| 26 | 1760030 | 1760236 | - | NZ_LS483436.1 | Streptococcus intermedius |
| 27 | 2170612 | 2170821 | + | NZ_CP014699.1 | Streptococcus pantholopis |
| 28 | 85741 | 85950 | + | NZ_CP031733.1 | Streptococcus chenjunshii |
| 29 | 490398 | 490604 | - | NZ_CP016953.1 | Streptococcus himalayensis |
| 30 | 76846 | 77052 | + | NC_012924.1 | Streptococcus suis SC84 |
| 31 | 1779308 | 1779514 | - | NZ_CP012805.1 | Streptococcus anginosus |
| 32 | 448418 | 448624 | - | NZ_CP032620.1 | Streptococcus koreensis |
| 33 | 89949 | 90155 | + | NZ_LS483383.1 | Streptococcus cristatus ATCC 51100 |
| 34 | 1751769 | 1751975 | - | NZ_LR134336.1 | Streptococcus oralis ATCC 35037 |
| 35 | 1971003 | 1971209 | + | NZ_CP032621.1 | Streptococcus gwangjuense |
| 36 | 295463 | 295669 | + | NC_015875.1 | Streptococcus pseudopneumoniae IS7493 |
| 37 | 73738 | 73944 | + | NZ_CP065061.1 | Streptococcus equi subsp. zooepidemicus |
| 38 | 504246 | 504452 | - | NZ_LR134293.1 | Streptococcus canis |
| 39 | 74459 | 74665 | + | NZ_LR594046.1 | Streptococcus dysgalactiae |
| 40 | 1857491 | 1857697 | - | NZ_LR134275.1 | Streptococcus vestibularis |
| 41 | 1839314 | 1839520 | - | NC_017581.1 | Streptococcus thermophilus JIM 8232 |
| 42 | 59537 | 59743 | + | NZ_LR594050.1 | Streptococcus porcinus |
| 43 | 1169382 | 1169588 | - | NZ_LR134341.1 | Streptococcus pseudoporcinus |
| 44 | 1510281 | 1510487 | - | NZ_CP045240.1 | Limosilactobacillus vaginalis |
| 45 | 530534 | 530740 | + | NZ_LN898144.1 | Paucilactobacillus oligofermentans DSM 15707 = LMG 22743 |
| 46 | 1398805 | 1399011 | - | NZ_CP044534.1 | Limosilactobacillus frumenti |
| 47 | 1564044 | 1564250 | - | NZ_CP045605.1 | Limosilactobacillus reuteri |
| 48 | 394355 | 394552 | + | NZ_CP044496.1 | Lactobacillus acetotolerans |
| 49 | 1317456 | 1317662 | - | NZ_CP045530.1 | Limosilactobacillus pontis |
| 50 | 104699 | 104875 | + | NZ_CP017326.1 | Weissella soli |
| 51 | 310915 | 311121 | + | NZ_CP027563.1 | Weissella confusa |
| 52 | 2129947 | 2130141 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 53 | 95965 | 96135 | + | NZ_CP041364.1 | Schleiferilactobacillus harbinensis |
| 54 | 354918 | 355115 | + | NZ_AP019750.1 | Lactobacillus delbrueckii subsp. delbrueckii |
| 55 | 295175 | 295372 | + | NC_021181.2 | Lactobacillus acidophilus La-14 |
| 56 | 358394 | 358591 | + | NZ_CP061341.1 | Lactobacillus kefiranofaciens |
| 57 | 398170 | 398367 | + | NZ_CP059829.1 | Lactobacillus ultunensis |
| 58 | 1808604 | 1808810 | - | NZ_CP014332.1 | Weissella jogaejeotgali |
| 59 | 274306 | 274503 | + | NZ_CP031835.1 | Lactobacillus amylolyticus |
| 60 | 754885 | 755091 | - | NZ_CP053988.1 | Abiotrophia defectiva |
| 61 | 948901 | 949101 | + | NZ_CP009240.1 | Megasphaera elsdenii 14-14 |
| 62 | 806464 | 806664 | - | NZ_CP029462.1 | Megasphaera stantonii |
| 63 | 1377659 | 1377856 | - | NZ_CP029544.1 | Lactobacillus helsingborgensis |
| 64 | 1466931 | 1467128 | - | NZ_CP029477.1 | Lactobacillus kullabergensis |
| 65 | 36728 | 36934 | + | NZ_CP023501.1 | Weissella paramesenteroides |
| 66 | 1546433 | 1546630 | - | NZ_CP015444.1 | Lactobacillus helveticus |
| 67 | 342289 | 342486 | + | NZ_CP059276.1 | Lactobacillus taiwanensis |
| 68 | 337584 | 337781 | + | NC_008530.1 | Lactobacillus gasseri ATCC 33323 = JCM 1131 |
| 69 | 340531 | 340728 | + | NZ_AP018549.1 | Lactobacillus paragasseri |
| 70 | 1291034 | 1291225 | + | NZ_CP023643.1 | Brochothrix thermosphacta |
| 71 | 406392 | 406589 | + | NZ_CP018809.1 | Lactobacillus jensenii |
| 72 | 1277853 | 1278050 | - | NZ_CP029476.1 | Lactobacillus apis |
| 73 | 2009993 | 2010199 | + | NZ_LT996885.1 | Dialister massiliensis |
| 74 | 190498 | 190707 | - | NZ_CP046314.1 | Gemella morbillorum |
| 75 | 1758715 | 1758924 | - | NZ_LR134484.1 | Gemella haemolysans |
| 76 | 181830 | 182036 | + | NZ_CP061835.1 | Weissella viridescens |
| 77 | 2443035 | 2443229 | - | NZ_AP012544.1 | Lacticaseibacillus casei DSM 20011 = JCM 1134 = ATCC 393 |
| 78 | 2442974 | 2443168 | - | NZ_LS991421.1 | Lacticaseibacillus zeae |
| 79 | 742501 | 742698 | + | NZ_CP017713.1 | Loigolactobacillus coryniformis subsp. coryniformis KCTC 3167 = DSM 20001 |
| 80 | 2012442 | 2012627 | - | NC_006085.1 | Cutibacterium acnes KPA171202 |
| 81 | 1637731 | 1637919 | - | NC_015437.1 | Selenomonas sputigena ATCC 35185 |
| 82 | 1520167 | 1520337 | - | NZ_LT906446.1 | Megamonas hypermegale |
| 83 | 1671213 | 1671392 | - | NZ_LT906470.1 | Veillonella rodentium |
| 84 | 1613467 | 1613646 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 85 | 1670063 | 1670242 | - | NZ_LR134375.1 | Veillonella dispar |
| 86 | 1729730 | 1729909 | - | NZ_LR778174.1 | Veillonella parvula |
| 87 | 223371 | 223565 | + | NZ_CP045007.1 | Latilactobacillus graminis |
| 88 | 1350349 | 1350543 | - | NZ_CP026116.1 | Latilactobacillus curvatus JCM 1096 = DSM 20019 |
| 89 | 603816 | 604010 | - | NZ_CP046037.1 | Latilactobacillus sakei |
| 90 | 415686 | 415856 | + | NZ_CP011391.1 | Faecalibaculum rodentium |
| 91 | 565408 | 565614 | + | NZ_AP014680.1 | Paucilactobacillus hokkaidonensis JCM 18461 |
| 92 | 1098305 | 1098499 | - | NZ_CP045563.1 | Fructilactobacillus sanfranciscensis |
| 93 | 1260685 | 1260879 | - | NC_016605.1 | Pediococcus claussenii ATCC BAA-344 |
| 94 | 2401899 | 2402093 | - | NC_014334.2 | Lacticaseibacillus paracasei |
| 95 | 218258 | 218434 | + | NC_015519.1 | Tepidanaerobacter acetatoxydans Re1 |
| 96 | 1565174 | 1565368 | - | NZ_CP047141.1 | Ligilactobacillus animalis |
| 97 | 793049 | 793219 | + | NZ_CP014872.1 | Fructilactobacillus lindneri |
| 98 | 2392846 | 2393040 | - | NZ_CP059603.1 | Levilactobacillus suantsaii |
| 99 | 1100957 | 1101127 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 100 | 1388394 | 1388588 | - | NC_008525.1 | Pediococcus pentosaceus ATCC 25745 |
| 101 | 1563886 | 1564080 | - | NZ_CP053421.1 | Pediococcus acidilactici |
| 102 | 2539138 | 2539338 | - | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 103 | 1280168 | 1280362 | - | NZ_CP037940.1 | Weissella cryptocerci |
| 104 | 1422325 | 1422519 | - | NZ_CP011403.1 | Ligilactobacillus salivarius str. Ren |
| 105 | 169382 | 169573 | + | NZ_AP019827.1 | Leptotrichia shahii |
| 106 | 129794 | 129985 | + | NZ_AP019846.1 | Leptotrichia hongkongensis |
| 107 | 2130241 | 2130432 | - | NZ_AP019829.2 | Leptotrichia wadei |
| 108 | 248047 | 248238 | + | NC_013192.1 | Leptotrichia buccalis C-1013-b |
| 109 | 2521376 | 2521567 | - | NZ_AP019845.1 | Leptotrichia trevisanii |
| 110 | 184965 | 185165 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 111 | 155853 | 156053 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 112 | 1151266 | 1151439 | + | NZ_CP011801.1 | Nitrospira moscoviensis |
| 113 | 551274 | 551444 | + | NZ_CP030105.1 | Lactiplantibacillus plantarum |
| 114 | 1065784 | 1065954 | + | NZ_CP032757.1 | Lactiplantibacillus pentosus |
| 115 | 195242 | 195436 | - | NZ_CP029971.1 | Lentilactobacillus kefiri |
| 116 | 1792132 | 1792326 | + | NZ_CP018796.1 | Lentilactobacillus parabuchneri |
| 117 | 1449468 | 1449656 | - | NC_022538.1 | Acholeplasma palmae J233 |
| 118 | 143151 | 143351 | + | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 119 | 2634665 | 2634898 | + | NZ_LR214441.1 | Tessaracoccus lapidicaptus |
| 120 | 32566 | 32769 | - | NZ_CP036523.1 | Peptacetobacter hiranonis |
| 121 | 52654 | 52854 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 122 | 148351 | 148551 | + | NC_017668.1 | Halobacillus halophilus DSM 2266 |
| 123 | 401942 | 402136 | + | NZ_CP045562.1 | Fructilactobacillus fructivorans |
| 124 | 444583 | 444771 | + | NZ_AP017378.1 | Desulfovibrio ferrophilus |
| 125 | 282422 | 282616 | - | NZ_CP012294.1 | Pediococcus damnosus |
| 126 | 516835 | 517029 | + | NZ_CP019981.1 | Pediococcus inopinatus |
| 127 | 2577651 | 2577854 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 128 | 2436116 | 2436319 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 129 | 477393 | 477587 | + | NZ_AP024085.1 | Faecalibacillus intestinalis |
| 130 | 1103098 | 1103307 | + | NZ_CP029684.2 | Oenococcus sicerae |
| 131 | 1454312 | 1454485 | - | NZ_CP054836.1 | Oricola thermophila |
| 132 | 134606 | 134806 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 133 | 3453531 | 3453731 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 134 | 135171 | 135374 | + | NZ_CP065425.1 | Heyndrickxia vini |
| 135 | 2574412 | 2574612 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 136 | 616379 | 616612 | - | NZ_CP019607.1 | Tessaracoccus flavescens |
| 137 | 1784304 | 1784504 | + | NZ_CP032694.1 | Rhizobium jaguaris |
| 138 | 1525667 | 1525867 | + | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 139 | 151793 | 151993 | + | NZ_CP017962.1 | Virgibacillus halodenitrificans |
| 140 | 547526 | 547735 | + | NZ_CP014324.1 | Oenococcus oeni |
| 141 | 85979 | 86182 | + | NZ_CP014150.1 | Paeniclostridium sordellii |
| 142 | 3950415 | 3950618 | - | NZ_CP019870.1 | Clostridioides difficile |
| 143 | 1137393 | 1137608 | + | NZ_CP016757.1 | Cloacibacillus porcorum |
| 144 | 2863649 | 2863858 | + | NZ_CP036402.1 | Egibacter rhizosphaerae |
| 145 | 1752290 | 1752490 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 146 | 2262994 | 2263188 | - | NZ_CP047121.1 | Lentilactobacillus hilgardii |
| 147 | 701939 | 702121 | + | NC_016148.1 | Thermovirga lienii DSM 17291 |
| 148 | 334989 | 335189 | + | NZ_CP014616.1 | Sporosarcina psychrophila |
| 149 | 2216890 | 2217096 | - | NC_012982.1 | Hirschia baltica ATCC 49814 |
| 150 | 628026 | 628220 | + | NZ_CP044499.1 | Lapidilactobacillus dextrinicus |
| 151 | 1368713 | 1368907 | + | NZ_CP018906.1 | Lentilactobacillus curieae |
| 152 | 426031 | 426225 | - | NZ_CP018888.1 | Amylolactobacillus amylophilus DSM 20533 = JCM 1125 |
| 153 | 2216906 | 2217100 | + | NZ_CP012033.1 | Levilactobacillus koreensis |
| 154 | 941205 | 941411 | + | NZ_CP067016.1 | Anaerococcus obesiensis |
| 155 | 325904 | 326110 | + | NZ_CP066014.1 | Anaerococcus vaginalis |
| 156 | 428519 | 428713 | + | NZ_CP032626.1 | Apilactobacillus bombintestini |
| 157 | 275124 | 275312 | + | NC_022549.1 | Acholeplasma brassicae |
| 158 | 413766 | 413999 | + | NZ_CP060789.1 | Tessaracoccus defluvii |
| 159 | 1370395 | 1370595 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 160 | 2162413 | 2162616 | - | NZ_CP029487.1 | Eubacterium maltosivorans |
| 161 | 339884 | 340078 | - | NZ_CP042371.1 | Secundilactobacillus malefermentans |
| 162 | 1318653 | 1318835 | - | NZ_LT635480.1 | Ndongobacter massiliensis |
| 163 | 145929 | 146129 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 164 | 479266 | 479472 | - | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 165 | 142923 | 143126 | + | NZ_CP012024.1 | Bacillus smithii |
| 166 | 1942057 | 1942257 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 167 | 145633 | 145836 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 168 | 132200 | 132397 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 169 | 1146120 | 1146314 | + | NZ_CP053187.1 | Turicibacter sanguinis |
| 170 | 124152 | 124352 | + | NZ_CP012152.1 | Anoxybacillus gonensis |
| 171 | 2074785 | 2075012 | - | NZ_LT985188.1 | Micropruina glycogenica |
| 172 | 1772901 | 1773095 | - | NZ_LS483405.1 | Levilactobacillus brevis |
| 173 | 146226 | 146426 | + | NZ_CP016537.2 | Planococcus halocryophilus |
| 174 | 4720653 | 4720886 | - | NC_013757.1 | Geodermatophilus obscurus DSM 43160 |
| 175 | 166360 | 166560 | + | NZ_CP016543.2 | Planococcus donghaensis |
| 176 | 345945 | 346151 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 177 | 1488434 | 1488634 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 178 | 113204 | 113404 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 179 | 1405500 | 1405700 | - | NZ_CP043404.1 | Bacillus safensis |
| 180 | 2424593 | 2424763 | - | NZ_LR134406.1 | Arachnia propionica |
| 181 | 138039 | 138239 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 182 | 170519 | 170719 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 183 | 146504 | 146704 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 184 | 805692 | 805898 | - | NZ_LT635475.1 | Ezakiella massiliensis |
| 185 | 2571319 | 2571525 | + | NZ_CP070062.1 | Coprococcus comes |
| 186 | 1059150 | 1059350 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 187 | 1889593 | 1889826 | - | NZ_CP019606.1 | Tessaracoccus aquimaris |
| 188 | 3058325 | 3058537 | + | NZ_CP051131.1 | Parasphingopyxis algicola |
| 189 | 1361428 | 1361664 | - | NZ_CP036404.1 | Komagataeibacter saccharivorans |
| 190 | 2694784 | 2694987 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 191 | 1303073 | 1303276 | + | NC_007794.1 | Novosphingobium aromaticivorans DSM 12444 |
| 192 | 167930 | 168130 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 193 | 267254 | 267448 | - | NZ_LT996886.1 | Tessaracoccus timonensis |
| 194 | 3268666 | 3268866 | + | NZ_CP064060.1 | Anoxybacillus caldiproteolyticus |
| 195 | 2117966 | 2118166 | + | NZ_CP015108.1 | Sporosarcina ureae |
| 196 | 143230 | 143430 | + | NZ_CP016539.2 | Planococcus plakortidis |
| 197 | 3078565 | 3078765 | - | NZ_CP042345.1 | Novosphingobium ginsenosidimutans |
| 198 | 3790457 | 3790657 | - | NZ_CP011937.1 | Bacillus velezensis |
| 199 | 275912 | 276112 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 200 | 139865 | 140065 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 201 | 140884 | 141084 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 202 | 139625 | 139825 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 203 | 139751 | 139951 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 204 | 109645 | 109845 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 205 | 1869577 | 1869777 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 206 | 139924 | 140124 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 207 | 254493 | 254696 | + | NZ_CP053989.1 | Niallia circulans |
| 208 | 2304374 | 2304547 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 209 | 4097249 | 4097464 | - | NZ_CP029553.1 | Methylobacterium terrae |
| 210 | 134198 | 134398 | + | NZ_CP016540.2 | Planococcus versutus |
| 211 | 143858 | 144058 | + | NZ_CP016538.2 | Planococcus maritimus |
| 212 | 143699 | 143899 | + | NZ_CP059540.1 | Planococcus maritimus |
| 213 | 1616306 | 1616506 | - | NZ_CP013661.2 | Planococcus kocurii |
| 214 | 146371 | 146571 | + | NZ_CP019401.1 | Planococcus faecalis |
| 215 | 3332017 | 3332217 | + | NZ_CP013659.2 | Planococcus rifietoensis |
| 216 | 150886 | 151086 | + | NZ_CP016534.2 | Planococcus antarcticus DSM 14505 |
| 217 | 2135708 | 2135914 | - | NZ_CP029256.1 | Christensenella minuta |
| 218 | 3433758 | 3433928 | - | NZ_AP014924.1 | Limnochorda pilosa |
| 219 | 202312 | 202515 | + | NC_019978.1 | Halobacteroides halobius DSM 5150 |
| 220 | 132555 | 132758 | + | NZ_LS483476.1 | Lederbergia lentus |
| 221 | 2745838 | 2746059 | - | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 222 | 224390 | 224563 | + | NC_010718.1 | Natranaerobius thermophilus JW/NM-WN-LF |
| 223 | 182435 | 182614 | - | NZ_CP014525.1 | Haematospirillum jordaniae |
| 224 | 1326071 | 1326247 | - | NZ_CP013213.1 | Erysipelothrix larvae |
| 225 | 506528 | 506722 | + | NZ_CP016843.1 | Carnobacterium divergens |
| 226 | 2018883 | 2019062 | + | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 227 | 1480448 | 1480651 | - | NZ_AP017470.1 | Thermotomaculum hydrothermale |
| 228 | 1036427 | 1036600 | - | NZ_CP008796.1 | Thermodesulfobacterium commune DSM 2178 |
| 229 | 1149089 | 1149301 | - | NC_007940.1 | Rickettsia bellii RML369-C |
| 230 | 587711 | 587902 | + | NZ_CP070624.1 | Photobacterium damselae subsp. damselae |
| 231 | 421971 | 422204 | + | NZ_CP008944.1 | Corynebacterium atypicum |
| 232 | 2864598 | 2864822 | - | NZ_CP011502.1 | Aeromicrobium erythreum |
| 233 | 3369266 | 3369469 | - | NZ_CP025197.1 | Acetivibrio saccincola |
| 234 | 1324136 | 1324330 | + | NC_012881.1 | Maridesulfovibrio salexigens DSM 2638 |
| 235 | 2276625 | 2276846 | + | NC_011891.1 | Anaeromyxobacter dehalogenans 2CP-1 |
| 236 | 270171 | 270362 | + | NZ_CP071325.1 | Photobacterium ganghwense |
| 237 | 610734 | 610925 | + | NZ_CP005974.1 | Photobacterium gaetbulicola Gung47 |
| 238 | 2422539 | 2422748 | - | NZ_CP031357.1 | Erythrobacter aureus |
| 239 | 2454702 | 2454893 | - | NC_014844.1 | Pseudodesulfovibrio aespoeensis Aspo-2 |
| 240 | 4497945 | 4498148 | - | NC_016627.1 | Acetivibrio clariflavus DSM 19732 |
| 241 | 457645 | 457836 | - | NZ_CP022355.1 | Paraphotobacterium marinum |
| 242 | 2195164 | 2195373 | - | NZ_AP019389.1 | Qipengyuania flava |
| 243 | 3231994 | 3232185 | - | NC_014365.1 | Desulfarculus baarsii DSM 2075 |
| 244 | 1726007 | 1726216 | - | NZ_LT906464.1 | Staphylococcus muscae |
| 245 | 2328947 | 2329147 | + | NZ_AP019711.1 | Amedibacterium intestinale |
| 246 | 293777 | 293971 | + | NZ_CP018180.1 | Liquorilactobacillus nagelii |
| 247 | 477070 | 477261 | + | NZ_CP042220.2 | Dickeya poaceiphila |
| 248 | 4043447 | 4043638 | - | NZ_LT615367.1 | Dickeya aquatica |
| 249 | 455021 | 455212 | + | NC_012880.1 | Musicola paradisiaca Ech703 |
| 250 | 4187248 | 4187439 | - | NZ_CP025799.1 | Dickeya zeae |
| 251 | 380343 | 380534 | + | NC_012912.1 | Dickeya chrysanthemi Ech1591 |
| 252 | 4387154 | 4387345 | - | NC_014500.1 | Dickeya dadantii 3937 |
| 253 | 3318774 | 3318965 | + | NZ_CP009460.1 | Dickeya fangzhongdai |
| 254 | 2620016 | 2620207 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 255 | 124994 | 125185 | - | NC_013456.1 | Vibrio antiquarius |
| 256 | 2996135 | 2996326 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 257 | 326646 | 326843 | + | NZ_CP018799.1 | Mariprofundus aestuarium |
| 258 | 987767 | 988000 | - | NZ_CP007519.1 | Trueperella pyogenes |
| 259 | 2171430 | 2171621 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 260 | 474184 | 474360 | + | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 261 | 2702241 | 2702432 | - | NZ_CP016414.1 | Vibrio scophthalmi |
| 262 | 213723 | 213923 | + | NC_013895.2 | Mageeibacillus indolicus UPII9-5 |
| 263 | 434608 | 434787 | + | NZ_AP018558.1 | Hydrogenophilus thermoluteolus |
| 264 | 547287 | 547478 | + | NZ_CP031415.1 | Saccharospirillum mangrovi |
| 265 | 2278126 | 2278317 | - | NZ_CP035688.1 | Vibrio metoecus |
| 266 | 2620372 | 2620563 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 267 | 3096292 | 3096483 | + | NZ_CP014035.2 | Vibrio fluvialis |
| 268 | 2716930 | 2717121 | - | NZ_AP019651.1 | Vibrio taketomensis |
| 269 | 2853393 | 2853584 | - | NZ_CP032093.1 | Vibrio alfacsensis |
| 270 | 3184255 | 3184446 | + | NZ_AP019657.1 | Vibrio ponticus |
| 271 | 408956 | 409147 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 272 | 280258 | 280449 | + | NZ_CP030788.1 | Vibrio campbellii |
| 273 | 255227 | 255418 | + | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 274 | 2822526 | 2822717 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 275 | 1543835 | 1544026 | - | NZ_CP019959.1 | Vibrio owensii |
| 276 | 487958 | 488149 | + | NZ_CP009467.1 | Vibrio harveyi |
| 277 | 1956313 | 1956504 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 278 | 1787332 | 1787523 | + | NZ_CP065150.1 | Vibrio kanaloae |
| 279 | 2975575 | 2975766 | - | NC_011753.2 | Vibrio atlanticus |
| 280 | 312625 | 312816 | + | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 281 | 3799569 | 3799760 | + | NZ_CP027107.1 | Cronobacter sakazakii |
| 282 | 226826 | 227017 | + | NZ_CP013940.1 | Cronobacter malonaticus LMG 23826 |
| 283 | 3886917 | 3887108 | - | NZ_CP012257.1 | Cronobacter universalis NCTC 9529 |
| 284 | 3964272 | 3964463 | - | NZ_CP012264.1 | Cronobacter condimenti 1330 |
| 285 | 80807 | 80998 | + | NZ_CP012268.1 | Cronobacter muytjensii ATCC 51329 |
| 286 | 4054161 | 4054352 | - | NZ_CP012266.1 | Cronobacter dublinensis subsp. dublinensis LMG 23823 |
| 287 | 408233 | 408424 | + | NZ_CP035129.1 | Kosakonia cowanii |
| 288 | 2693153 | 2693344 | - | NZ_CP016337.1 | Kosakonia sacchari |
| 289 | 4443214 | 4443405 | - | NZ_CP063425.1 | Kosakonia pseudosacchari |
| 290 | 711873 | 712064 | - | NZ_CP040428.1 | Jejubacter calystegiae |
| 291 | 453854 | 454045 | + | NZ_CP014007.2 | Kosakonia oryzae |
| 292 | 4870195 | 4870386 | - | NZ_CP015113.1 | Kosakonia radicincitans |
| 293 | 405477 | 405668 | + | NZ_CP061511.1 | Mixta calida |
| 294 | 480094 | 480285 | + | NZ_CP026377.1 | Mixta gaviniae |
| 295 | 2851611 | 2851802 | - | NZ_CP045350.1 | Vibrio aquimaris |
| 296 | 319176 | 319367 | + | NZ_CP065534.1 | Lonsdalea populi |
| 297 | 747008 | 747199 | - | NZ_CP023009.1 | Lonsdalea britannica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_022369.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00253.23 | 0.82 | 243 | 1645.0 | same-strand | Ribosomal protein S14p/S29e |
| 2 | PF00673.23 | 0.97 | 288 | 1080 | same-strand | ribosomal L5P family C-terminus |
| 3 | PF00281.21 | 0.97 | 288 | 1080 | same-strand | Ribosomal protein L5 |
| 4 | PF17136.6 | 0.93 | 274 | 745 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 5 | PF00467.31 | 0.92 | 272 | 740 | same-strand | KOW motif |
| 6 | PF00238.21 | 0.98 | 291 | 329.0 | same-strand | Ribosomal protein L14p/L23e |
| 7 | PF00366.22 | 1.0 | 296 | 22 | same-strand | Ribosomal protein S17 |
| 8 | PF00252.20 | 1.0 | 296 | 0 | same-strand | Ribosomal protein L16p/L10e |
| 9 | PF00189.22 | 1.0 | 296 | 427 | same-strand | Ribosomal protein S3, C-terminal domain |
| 10 | PF07650.19 | 1.0 | 296 | 427 | same-strand | KH domain |
| 11 | PF00237.21 | 1.0 | 296 | 1111 | same-strand | Ribosomal protein L22p/L17e |
| 12 | PF00203.23 | 1.0 | 296 | 1475 | same-strand | Ribosomal protein S19 |
| 13 | PF03947.20 | 1.0 | 296 | 1794 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 14 | PF00181.25 | 1.0 | 296 | 1794 | same-strand | Ribosomal Proteins L2, RNA binding domain |
++ More..