Result : Q9CBU2
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Uncharacterized protein ML1584 |
| NCBI Accession ID | AL583922.1 |
| Organism | Mycobacterium leprae (strain TN) |
| Left | 228790 |
| Right | 229044 |
| Strand | + |
| Nucleotide Sequence | GTGGCCAGCACTGAGGGGGAGCACAATGCCGGCGTCGACCCTGCTGAAGTGCCGTCCGTGGCGTGGGGGTGGAGCAGAATCAACCACCACACCTGGCACATCGTCGGTTTGTTCGCCATTGGGTTGCTGCTGGCGATGCTGCGCGGCAACCACATTGGCCATGTCGAGAACTGGTATCTCATCGGGTTTGCCGCCCTGGTGTTCTTCGTTTTGATCCGTGACCTGCTAGGTCGCCGACGCGGTTGGATTAGATAG |
| Sequence | MASTEGEHNAGVDPAEVPSVAWGWSRINHHTWHIVGLFAIGLLLAMLRGNHIGHVENWYLIGFAALVFFVLIRDLLGRRRGWIR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of pfam10939. Profile Description: Protein of unknown function (DUF2631). This is s bacterial family of proteins with unknown function. |
| Pubmed ID | 11234002 |
| Domain | CDD:402495 |
| Functional Category | Others |
| Uniprot ID | Q9CBU2 |
| ORF Length (Amino Acid) | 84 |
++ More..
| Conservation Analysis |
No. of Species: 75
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 1862942 | 1863196 | + | NZ_CP029543.1 | Mycobacterium leprae |
| 2 | 1504971 | 1505225 | - | NZ_CP011883.2 | Mycobacterium haemophilum DSM 44634 |
| 3 | 3535802 | 3536056 | + | NZ_CP009360.4 | Mycobacterium avium subsp. hominissuis |
| 4 | 3917327 | 3917581 | + | NC_016948.1 | Mycobacterium paraintracellulare |
| 5 | 3798701 | 3798955 | + | NC_016946.1 | Mycobacterium intracellulare ATCC 13950 |
| 6 | 215359 | 215613 | - | NZ_AP022590.1 | Mycobacterium mantenii |
| 7 | 3645643 | 3645897 | + | NZ_CP023147.1 | Mycobacterium marseillense |
| 8 | 2979310 | 2979564 | + | NZ_AP022581.1 | Mycobacterium lacus |
| 9 | 5862592 | 5862846 | - | NZ_AP022619.1 | Mycobacterium paraseoulense |
| 10 | 3187711 | 3187977 | + | NC_000962.3 | Mycobacterium tuberculosis H37Rv |
| 11 | 3246346 | 3246612 | + | NC_015848.1 | Mycobacterium canettii CIPT 140010059 |
| 12 | 1882003 | 1882254 | - | NZ_LR130759.1 | Mycobacterium basiliense |
| 13 | 484705 | 484959 | - | NZ_AP022582.1 | Mycobacterium seoulense |
| 14 | 2298086 | 2298340 | - | NZ_CP025546.1 | Mycobacterium paragordonae |
| 15 | 2445086 | 2445340 | + | NZ_AP022575.1 | Mycobacterium shinjukuense |
| 16 | 1613198 | 1613452 | - | NZ_AP022613.1 | Mycobacterium conspicuum |
| 17 | 373315 | 373569 | + | NZ_AP022615.1 | Mycobacterium heidelbergense |
| 18 | 2512084 | 2512338 | + | NZ_AP022614.1 | Mycobacterium parmense |
| 19 | 2159356 | 2159610 | + | NZ_AP022609.1 | Mycolicibacter hiberniae |
| 20 | 729791 | 730045 | + | NZ_AP022568.1 | Mycobacterium simiae |
| 21 | 5414930 | 5415184 | - | NC_022663.1 | Mycobacterium kansasii ATCC 12478 |
| 22 | 540315 | 540569 | - | NZ_AP022620.1 | Mycolicibacterium anyangense |
| 23 | 3407651 | 3407857 | - | NZ_AP022583.1 | Mycobacterium noviomagense |
| 24 | 1789047 | 1789301 | - | NZ_AP018164.1 | Mycobacterium shigaense |
| 25 | 285737 | 285991 | + | NZ_AP022589.1 | Mycolicibacter minnesotensis |
| 26 | 4826491 | 4826745 | + | NZ_AP022606.1 | Mycobacterium branderi |
| 27 | 3661388 | 3661639 | - | NZ_AP022562.1 | Mycobacterium novum |
| 28 | 2784941 | 2785192 | + | NC_015576.1 | Mycolicibacter sinensis |
| 29 | 2724744 | 2724995 | + | NZ_LT906469.1 | Mycolicibacter terrae |
| 30 | 3113138 | 3113392 | + | NZ_AP022612.1 | Mycolicibacterium confluentis |
| 31 | 1943136 | 1943390 | - | NZ_AP022561.1 | Mycolicibacterium aichiense |
| 32 | 4133667 | 4133921 | - | NZ_AP022600.1 | Mycolicibacterium tokaiense |
| 33 | 1761872 | 1762126 | + | NZ_AP022587.1 | Mycobacterium stomatepiae |
| 34 | 1681302 | 1681556 | + | NZ_AP022576.1 | Mycobacterium florentinum |
| 35 | 5189660 | 5189914 | + | NZ_AP022572.1 | Mycobacterium shottsii |
| 36 | 5715208 | 5715471 | - | NZ_AP022573.1 | Mycobacterium saskatchewanense |
| 37 | 3143350 | 3143604 | + | NZ_LR134355.1 | Mycolicibacterium chitae |
| 38 | 1994966 | 1995220 | - | NZ_AP018410.1 | Mycobacterium pseudoshottsii JCM 15466 |
| 39 | 3582096 | 3582350 | - | NZ_CP058277.1 | Mycobacterium marinum |
| 40 | 3358031 | 3358237 | + | NZ_AP024310.1 | Mycobacterium heckeshornense |
| 41 | 2514581 | 2514835 | - | NZ_CP011269.1 | Mycolicibacterium fortuitum |
| 42 | 5205317 | 5205571 | + | NZ_AP022579.1 | Mycolicibacterium boenickei |
| 43 | 5695727 | 5695981 | - | NZ_AP022567.1 | Mycolicibacterium mageritense |
| 44 | 4690214 | 4690468 | - | NZ_AP022596.1 | Mycolicibacterium helvum |
| 45 | 4681618 | 4681872 | + | NZ_CP020809.1 | Mycobacterium dioxanotrophicus |
| 46 | 5739407 | 5739661 | + | NZ_CP012150.1 | Mycobacterium goodii |
| 47 | 1465062 | 1465316 | + | NZ_AP022565.1 | Mycolicibacterium alvei |
| 48 | 2161588 | 2161842 | - | NZ_AP022618.1 | Mycolicibacterium insubricum |
| 49 | 59383 | 59649 | - | NZ_AP022569.1 | Mycobacterium cookii |
| 50 | 2726027 | 2726281 | - | NZ_LN831039.1 | Mycolicibacterium smegmatis |
| 51 | 4204693 | 4204899 | + | NZ_AP022560.1 | Mycolicibacterium moriokaense |
| 52 | 3406078 | 3406332 | - | NZ_CP043474.1 | Mycobacterium grossiae |
| 53 | 1407405 | 1407659 | + | NZ_AP022616.1 | Mycolicibacterium phocaicum |
| 54 | 2303918 | 2304172 | - | NZ_AP022610.1 | Mycolicibacterium madagascariense |
| 55 | 2353696 | 2353950 | - | NZ_CP062008.1 | Mycolicibacterium mucogenicum DSM 44124 |
| 56 | 1654222 | 1654482 | + | NZ_AP022608.1 | Mycolicibacterium gadium |
| 57 | 235696 | 235959 | + | NZ_AP022599.1 | Mycolicibacterium pulveris |
| 58 | 751791 | 752051 | - | NZ_AP022601.1 | Mycobacterium gallinarum |
| 59 | 306896 | 307162 | - | NZ_AP022603.1 | Mycolicibacterium fallax |
| 60 | 3135100 | 3135354 | - | NZ_AP022595.1 | Mycolicibacterium sarraceniae |
| 61 | 2346315 | 2346569 | + | NZ_AP022586.1 | Mycolicibacterium litorale |
| 62 | 4793685 | 4793954 | + | NZ_CP018082.1 | Nocardia mangyaensis |
| 63 | 2261205 | 2261459 | - | NZ_CP011491.1 | Mycolicibacterium vaccae 95051 |
| 64 | 5720850 | 5721104 | - | NZ_AP022577.1 | Mycolicibacterium aubagnense |
| 65 | 5659021 | 5659290 | + | NZ_LR134352.1 | Nocardia asteroides |
| 66 | 2747486 | 2747740 | + | NZ_AP022617.1 | Mycolicibacterium monacense |
| 67 | 2405982 | 2406236 | - | NC_008726.1 | Mycolicibacterium vanbaalenii PYR-1 |
| 68 | 2450401 | 2450628 | + | NZ_CP048813.1 | Rhodococcus triatomae |
| 69 | 2141761 | 2141991 | - | NZ_CP029146.1 | Rhodococcus ruber |
| 70 | 1397789 | 1398043 | - | NZ_AP022605.1 | Mycobacterium doricum |
| 71 | 2698514 | 2698768 | - | NZ_AP022570.1 | Mycolicibacterium poriferae |
| 72 | 2652924 | 2653187 | + | NZ_LR026975.1 | Mycolicibacterium hassiacum DSM 44199 |
| 73 | 2562931 | 2563158 | - | NZ_AP023172.1 | Rhodococcus qingshengii |
| 74 | 2370393 | 2370647 | + | NZ_AP022563.1 | Mycolicibacterium duvalii |
| 75 | 1778495 | 1778749 | - | NZ_LT906483.1 | Mycolicibacterium thermoresistibile |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP011883.2
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02163.24 | 0.64 | 48 | 1697.0 | opposite-strand | Peptidase family M50 |
| 2 | PF02670.18 | 0.72 | 54 | 861.5 | opposite-strand | 1-deoxy-D-xylulose 5-phosphate reductoisomerase |
| 3 | PF08436.14 | 0.72 | 54 | 861.5 | opposite-strand | 1-deoxy-D-xylulose 5-phosphate reductoisomerase C-terminal domain |
| 4 | PF13288.8 | 0.72 | 54 | 861.5 | opposite-strand | DXP reductoisomerase C-terminal domain |
| 5 | PF04055.23 | 0.64 | 48 | 1441.5 | opposite-strand | Radical SAM superfamily |
++ More..