Protein Information |
Information Type | Description |
---|---|
Protein name | Antitoxin epsilon 1 |
NCBI Accession ID | X92945.2 |
Organism | Enterococcus faecalis (Streptococcus faecalis) |
Left | 42666 |
Right | 42938 |
Strand | + |
Nucleotide Sequence | ATGGCAGTTACGTATGAAAAAACATTTGAAATTGAAATCATTAATGAGTTATCGGCAAGTGTTTATAATCGGGTATTAAATTATGTTTTGAATCATGAACTAGATACTAAAAATACTCGTTTACTAGAAGTGAATCTTTTAAATCAATTAGAAGTGGCACAAGAAGTTGATTTATTTCAACAACCATTTGAAGAATTACAAGCTATTCATGAGTATTGGCGGTCAATGAATCAATATTCAAAACAAATTTTGAATAAAGAGAAAGTGGCTTAA |
Sequence | MAVTYEKTFEIEIINELSASVYNRVLNYVLNHELDTKNTRLLEVNLLNQLEVAQEVDLFQQPFEELQAIHEYWRSMNQYSKQILNKEKVA |
Source of smORF | Swiss-Prot |
Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the toxic effect of zeta toxin. Part of a postsegregational killing (PSK) system involved in the killing of plasmid-free cells. Continuous synthesis of the epsilon antitoxin is required to counteract the zeta toxin (By similarity). {ECO:0000250}. |
Pubmed ID | 11735367 |
Domain | CDD:370234 |
Functional Category | Antitoxin_type_2 |
Uniprot ID | Q9AL01 |
ORF Length (Amino Acid) | 90 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 75169 | 75441 | - | NZ_AP022823.1 | Enterococcus saigonensis |
2 | 1249885 | 1250157 | + | NZ_CP049740.1 | Jeotgalibaca arthritidis |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00005.29 | 1.0 | 2 | 2633.5 | same-strand | ABC transporter |
2 | PF01381.24 | 1.0 | 2 | 1647.0 | same-strand | Helix-turn-helix |
3 | PF12844.9 | 1.0 | 2 | 1647.0 | same-strand | Helix-turn-helix domain |
4 | PF13443.8 | 1.0 | 2 | 1647.0 | same-strand | Cro/C1-type HTH DNA-binding domain |
5 | PF07764.13 | 1.0 | 2 | 18.0 | same-strand | Omega Transcriptional Repressor |