Result : Q9AA08
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin RelB1 |
| NCBI Accession ID | AE005673.1 |
| Organism | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) |
| Left | 890968 |
| Right | 891231 |
| Strand | - |
| Nucleotide Sequence | ATGGCCGATGGCTTCGACATTCATATCGATCAAGAGCAGGCCGCCCGGCTGAAGGTCGTTGCCGACCGCCTGGGTATGTCCGTGTCCGAGTACGCCGTTGCGCTGATCGACGCAGGGCTGACAGGCGCGGCGCCTAAAGCGATCGATCCGGACCCCGCCATCGACGAGGCCATCGCCGACGCCATCGAGCGGGGCGACGAGCCGGCGATTTCACGCGATGAGTTCCGCGCTCATATACGTCGCGTGACTGCGGGCCTGGGTTGA |
| Sequence | MADGFDIHIDQEQAARLKVVADRLGMSVSEYAVALIDAGLTGAAPKAIDPDPAIDEAIADAIERGDEPAISRDEFRAHIRRVTAGLG |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the effect of cognate toxin RelE1, but no other RelE or ParE toxin. {ECO:0000269|Pubmed:20487277}. |
| Pubmed ID | 11259647 15718296 20487277 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | Q9AA08 |
| ORF Length (Amino Acid) | 87 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 916999 | 917262 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 2336541 | 2336798 | - | NZ_CP026100.1 | Caulobacter flavus |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00171.24 | 1.0 | 2 | 43.0 | same-strand | Aldehyde dehydrogenase family |
| 2 | PF01619.20 | 1.0 | 2 | 43.0 | same-strand | Proline dehydrogenase |
| 3 | PF14850.8 | 1.0 | 2 | 43.0 | same-strand | DNA-binding domain of Proline dehydrogenase |
| 4 | PF01037.23 | 1.0 | 2 | 3578.0 | opposite-strand | Lrp/AsnC ligand binding domain |
| 5 | PF13412.8 | 1.0 | 2 | 3578.0 | opposite-strand | Winged helix-turn-helix DNA-binding |
| 6 | PF13404.8 | 1.0 | 2 | 3578.0 | opposite-strand | AsnC-type helix-turn-helix domain |
++ More..