ProsmORF-pred
Result : Q9A9T8
Protein Information
Information Type Description
Protein name Toxin ParE1
NCBI Accession ID AE005673.1
Organism Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)
Left 968678
Right 968968
Strand -
Nucleotide Sequence ATGAAGCCCTATCGGCTATCCCGTCGCGCCAAGGCCGACCTCGATGACATCTGGACCTATTCAGAGCAGCGATGGGGCGTTGAACAAGCCGCCGACTACGCCCGTGAACTGCAGGCCACCATCGAGATGATCGCTGAACATCCGGGTATGGGACAGCCGGATGAAAACCTCCGCGCGGGCTACAGGCGATGCGCCAGCGGCTCGCACGTGGTCTTTTACCGCGTCGGCGTGCGGGTCGAGATTATCCGCGTGCTACACCAAAGCATGAACGCCAGGGCTCACCTTGGCTGA
Sequence MKPYRLSRRAKADLDDIWTYSEQRWGVEQAADYARELQATIEMIAEHPGMGQPDENLRAGYRRCASGSHVVFYRVGVRVEIIRVLHQSMNARAHLG
Source of smORF Swiss-Prot
Function Toxic component of a type II toxin-antitoxin (TA) system. Its toxic effect is neutralized by coexpression with cognate antitoxin ParD1 but no other ParD or RelB antitoxin. Low levels of wild-type toxin in the absence of antitoxin decreases the rate of cell growth, and results in death or loss of colony formation abilities and greatly elongated cells. Low levels of a mutant missing the last 4 residues leads to loss of cell division while cell elongation continues. {ECO:0000269|Pubmed:20487277}.
Pubmed ID 11259647 15718296 20487277 20143871
Domain CDD:419697
Functional Category Toxin_type_2
Uniprot ID Q9A9T8
ORF Length (Amino Acid) 96
++ More..