Result : Q9A5V7
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | DNA gyrase inhibitor YacG |
| NCBI Accession ID | AE005673.1 |
| Organism | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) |
| Left | 2542852 |
| Right | 2543025 |
| Strand | - |
| Nucleotide Sequence | ATGAGCGCGAAATGTCCCATCTGCGCCAAGCCCGTTGATTCCGCGTTCCGCCCTTTCTGTTCGAAACGCTGCGCGGACGTGGATCTCCAGCGCTGGCTGAGCGGTCGCTACGTCGTGGCGGGTGGGGACGACGATGAAGAAAATCCGCCATCCCAAGACATCAACAGGGAATGA |
| Sequence | MSAKCPICAKPVDSAFRPFCSKRCADVDLQRWLSGRYVVAGGDDDEENPPSQDINRE |
| Source of smORF | Swiss-Prot |
| Function | Inhibits all the catalytic activities of DNA gyrase by preventing its interaction with DNA. Acts by binding directly to the C-terminal domain of GyrB, which probably disrupts DNA binding by the gyrase. {ECO:0000255|HAMAP-Rule:MF_00649}. |
| Pubmed ID | 11259647 |
| Domain | CDD:412768 |
| Functional Category | Metal-binding |
| Uniprot ID | Q9A5V7 |
| ORF Length (Amino Acid) | 57 |
++ More..
| Conservation Analysis |
No. of Species: 45
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2568833 | 2569006 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 3409403 | 3409576 | - | NZ_CP027850.1 | Caulobacter segnis |
| 3 | 5450794 | 5450964 | - | NZ_CP026100.1 | Caulobacter flavus |
| 4 | 1858391 | 1858561 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 5 | 1217855 | 1218034 | + | NZ_CP013002.1 | Caulobacter henricii |
| 6 | 461432 | 461614 | + | NZ_AP014946.1 | Variibacter gotjawalensis |
| 7 | 3038160 | 3038336 | - | NZ_CP024201.1 | Caulobacter mirabilis |
| 8 | 951486 | 951653 | + | NZ_CP029479.1 | Phenylobacterium parvum |
| 9 | 634923 | 635108 | - | NZ_CP029550.1 | Methylobacterium durans |
| 10 | 432057 | 432248 | + | NZ_CP034348.1 | Roseovarius faecimaris |
| 11 | 2256770 | 2256943 | - | NZ_CP061202.1 | Rhodobacter capsulatus |
| 12 | 1149564 | 1149740 | + | NZ_CP043043.1 | Gluconobacter thailandicus |
| 13 | 3262150 | 3262308 | + | NZ_CP034328.1 | Tabrizicola piscis |
| 14 | 720054 | 720212 | + | NZ_LN606600.1 | Acetobacter senegalensis |
| 15 | 1700795 | 1700980 | + | NZ_CP015164.1 | Acetobacter ascendens |
| 16 | 2614480 | 2614629 | - | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 17 | 2033129 | 2033314 | + | NZ_CP042808.1 | Acetobacter oryzoeni |
| 18 | 939784 | 939969 | + | NC_021991.1 | Acetobacter pasteurianus 386B |
| 19 | 2254303 | 2254488 | + | NZ_CP022374.1 | Acetobacter oryzifermentans |
| 20 | 2148349 | 2148516 | - | NZ_CP025583.1 | Paracoccus jeotgali |
| 21 | 1327065 | 1327247 | - | NZ_CP051181.1 | Thalassobius gelatinovorus |
| 22 | 2710846 | 2711049 | - | NZ_CP039546.1 | Methylorubrum populi |
| 23 | 1628769 | 1628939 | - | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
| 24 | 1217254 | 1217433 | + | NZ_CP004373.1 | Gluconobacter oxydans DSM 3504 |
| 25 | 75543 | 75725 | + | NC_006569.1 | Ruegeria pomeroyi DSS-3 |
| 26 | 3403495 | 3403689 | - | NC_015684.1 | Afipia carboxidovorans OM5 |
| 27 | 2467506 | 2467682 | + | NZ_CP024899.1 | Rhodobaca barguzinensis |
| 28 | 654703 | 654870 | - | NZ_CP068983.1 | Paradevosia shaoguanensis |
| 29 | 3353706 | 3353888 | - | NZ_CP003811.1 | Methylobacterium oryzae CBMB20 |
| 30 | 2564426 | 2564608 | - | NZ_CP015367.1 | Methylobacterium phyllosphaerae |
| 31 | 3415202 | 3415384 | - | NZ_CP004372.1 | Roseibacterium elongatum DSM 19469 |
| 32 | 1682888 | 1683064 | - | NZ_CP025430.1 | Paracoccus zhejiangensis |
| 33 | 2793467 | 2793646 | + | NZ_CP014689.1 | Gluconobacter albidus |
| 34 | 932368 | 932526 | - | NZ_CP032485.1 | Neokomagataea tanensis |
| 35 | 1179015 | 1179194 | + | NZ_CP068419.1 | Gluconobacter sphaericus |
| 36 | 3085464 | 3085661 | - | NC_015730.1 | Roseobacter litoralis Och 149 |
| 37 | 395154 | 395336 | + | NZ_CP015231.1 | Epibacterium mobile F1926 |
| 38 | 1889324 | 1889515 | - | NC_012982.1 | Hirschia baltica ATCC 49814 |
| 39 | 1798435 | 1798596 | - | NZ_CP038439.1 | Paracoccus liaowanqingii |
| 40 | 4600520 | 4600690 | + | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 41 | 317567 | 317734 | - | NC_014414.1 | Parvularcula bermudensis HTCC2503 |
| 42 | 2078627 | 2078791 | - | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 43 | 2930915 | 2931079 | + | NZ_CP022048.2 | Brevundimonas vesicularis |
| 44 | 1412602 | 1412793 | + | NZ_CP030918.1 | Paracoccus suum |
| 45 | 3813263 | 3813442 | - | NZ_CP018171.1 | Mesorhizobium oceanicum |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02545.16 | 0.89 | 40 | 1037.0 | same-strand | Maf-like protein |
| 2 | PF01176.21 | 0.82 | 37 | 1680 | same-strand | Translation initiation factor 1A / IF-1 |
++ More..