Result : Q9A5D6
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin RelB2 |
| NCBI Accession ID | AE005673.1 |
| Organism | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) |
| Left | 2719244 |
| Right | 2719444 |
| Strand | - |
| Nucleotide Sequence | ATGGCGATATGCTATGCTCGCTTCATGGTCCCCGAGCCGTCCATCTTCGAGATTGACGCGGAAGCCGAAGAGGCCGCCGATGCGGAAGGCATGGCCGACATCGCAGCCGGCCGCGTTGTACCCCACGAAGAGGTCTCCGCCTGGCTCGACACTTGGGGGACGCCCGAAGAAAAGCCCGCGCCCGAGACGTGGCGCAAGTAG |
| Sequence | MAICYARFMVPEPSIFEIDAEAEEAADAEGMADIAAGRVVPHEEVSAWLDTWGTPEEKPAPETWRK |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the effect of cognate toxin RelE2, but no other RelE or ParE toxin. {ECO:0000269|Pubmed:20487277}. |
| Pubmed ID | 11259647 15718296 20487277 |
| Domain | |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | Q9A5D6 |
| ORF Length (Amino Acid) | 66 |
++ More..
| Conservation Analysis |
No. of Species: 5
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 2745226 | 2745426 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 1123493 | 1123672 | + | NZ_CP013002.1 | Caulobacter henricii |
| 3 | 3221354 | 3221530 | + | NZ_CP013002.1 | Caulobacter henricii |
| 4 | 3423714 | 3423893 | - | NZ_CP035765.1 | Sphingomonas paucimobilis |
| 5 | 4536539 | 4536721 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 6 | 1170 | 1346 | - | NC_021978.1 | Acetobacter pasteurianus 386B |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05016.17 | 0.6 | 3 | -12 | same-strand | ParE toxin of type II toxin-antitoxin system, parDE |
++ More..