ProsmORF-pred
Result : Q9A4F4
Protein Information
Information Type Description
Protein name Toxin RelE3
NCBI Accession ID AE005673.1
Organism Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus)
Left 3103118
Right 3103396
Strand +
Nucleotide Sequence ATGAAATCCGTCGAGCTCGGCCCACGCGCCAGACGTGACTTGACCAAGTTGCGGCGCTGGCTGCTGAACCGAGCGCCCTCGGCGGCCGACCGGGCCATCGACCTTATCCTGAGCAGAGCCGAGCAGCTTGCCCAGCATTCCGACCTCGGCCGTCGAAAATCTCAGAACATGCGAGAACTTTACGTCTCCTTCGGCGCCCACGGTTATGTCCTGCAGTATCGCGTTTACCCCGACGCGGTCGTGATCGCCCGTATCCGACACAGCCTTGAACGTCGCTGA
Sequence MKSVELGPRARRDLTKLRRWLLNRAPSAADRAIDLILSRAEQLAQHSDLGRRKSQNMRELYVSFGAHGYVLQYRVYPDAVVIARIRHSLERR
Source of smORF Swiss-Prot
Function Toxic component of a type II toxin-antitoxin (TA) system. Its toxic effect is neutralized by coexpression with cognate antitoxin RelB3 but no other ParD or RelB antitoxin. {ECO:0000269|Pubmed:20487277}.
Pubmed ID 11259647 15718296 20487277
Domain CDD:419697
Functional Category Toxin_type_2
Uniprot ID Q9A4F4
ORF Length (Amino Acid) 92
++ More..
Conservation Analysis
Conservation Analysis
No. of Species: 2
Sr.No. Left Position Right Position Strand NCBI Accession id Species Name
1 3129098 3129376 + NC_011916.1 Caulobacter vibrioides NA1000
2 1028935 1029213 - NZ_CP027850.1 Caulobacter segnis
++ More..
Neighborhood Conservation Analysis
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Conservation Analysis
Neighborhood Representative Chosen(Species): NC_011916.1
Sr.No. Domain Co-occurrence Frequency No. of species in which domain occurs with smORF Median distance b/w smORF and domain bearing ORFs Orientation relative to smORF PFAM Information
1 PF13759.8 1.0 2 335.5 opposite-strand Putative 2OG-Fe(II) oxygenase
2 PF08459.13 1.0 2 29.5 same-strand UvrC RIbonuclease H-like domain
3 PF02151.21 1.0 2 29.5 same-strand UvrB/uvrC motif
4 PF01541.26 1.0 2 29.5 same-strand GIY-YIG catalytic domain
5 PF14520.8 1.0 2 29.5 same-strand Helix-hairpin-helix domain
6 PF02518.28 1.0 2 2723.5 both-strands Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase
7 PF00512.27 1.0 2 2723.5 both-strands His Kinase A (phospho-acceptor) domain
++ More..