Result : Q9A4F4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Toxin RelE3 |
| NCBI Accession ID | AE005673.1 |
| Organism | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) |
| Left | 3103118 |
| Right | 3103396 |
| Strand | + |
| Nucleotide Sequence | ATGAAATCCGTCGAGCTCGGCCCACGCGCCAGACGTGACTTGACCAAGTTGCGGCGCTGGCTGCTGAACCGAGCGCCCTCGGCGGCCGACCGGGCCATCGACCTTATCCTGAGCAGAGCCGAGCAGCTTGCCCAGCATTCCGACCTCGGCCGTCGAAAATCTCAGAACATGCGAGAACTTTACGTCTCCTTCGGCGCCCACGGTTATGTCCTGCAGTATCGCGTTTACCCCGACGCGGTCGTGATCGCCCGTATCCGACACAGCCTTGAACGTCGCTGA |
| Sequence | MKSVELGPRARRDLTKLRRWLLNRAPSAADRAIDLILSRAEQLAQHSDLGRRKSQNMRELYVSFGAHGYVLQYRVYPDAVVIARIRHSLERR |
| Source of smORF | Swiss-Prot |
| Function | Toxic component of a type II toxin-antitoxin (TA) system. Its toxic effect is neutralized by coexpression with cognate antitoxin RelB3 but no other ParD or RelB antitoxin. {ECO:0000269|Pubmed:20487277}. |
| Pubmed ID | 11259647 15718296 20487277 |
| Domain | CDD:419697 |
| Functional Category | Toxin_type_2 |
| Uniprot ID | Q9A4F4 |
| ORF Length (Amino Acid) | 92 |
++ More..
| Conservation Analysis |
No. of Species: 2
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3129098 | 3129376 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 1028935 | 1029213 | - | NZ_CP027850.1 | Caulobacter segnis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13759.8 | 1.0 | 2 | 335.5 | opposite-strand | Putative 2OG-Fe(II) oxygenase |
| 2 | PF08459.13 | 1.0 | 2 | 29.5 | same-strand | UvrC RIbonuclease H-like domain |
| 3 | PF02151.21 | 1.0 | 2 | 29.5 | same-strand | UvrB/uvrC motif |
| 4 | PF01541.26 | 1.0 | 2 | 29.5 | same-strand | GIY-YIG catalytic domain |
| 5 | PF14520.8 | 1.0 | 2 | 29.5 | same-strand | Helix-hairpin-helix domain |
| 6 | PF02518.28 | 1.0 | 2 | 2723.5 | both-strands | Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase |
| 7 | PF00512.27 | 1.0 | 2 | 2723.5 | both-strands | His Kinase A (phospho-acceptor) domain |
++ More..