Result : Q9A458
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Antitoxin ParD4 |
| NCBI Accession ID | AE005673.1 |
| Organism | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) |
| Left | 3202592 |
| Right | 3202882 |
| Strand | - |
| Nucleotide Sequence | TTGCCATCTAATGGCATCGTGAGGTCCTGGAGGCGCGCCATGGCGACGATGAATGTTTCCCTGCCCGATGCGATGCGCGAGTGGGTCGAGGGCCAGACCCAGTCGGGCCGCTATCACAACGCCAGCGAATACGTCCGTGACCTCATCCGTCGCGACCAGGAACGCGCCGACAAGATCGCCCACCTGCAACGCCTGATCGACGAAGGCCTAGACAGCGGCGTTGGCGAGCGCTCGCTGCATGAGATTCGCGCTGAGGCGCGGCGGCGGGCTGGTGTGGATCATGAGCTATAG |
| Sequence | MPSNGIVRSWRRAMATMNVSLPDAMREWVEGQTQSGRYHNASEYVRDLIRRDQERADKIAHLQRLIDEGLDSGVGERSLHEIRAEARRRAGVDHEL |
| Source of smORF | Swiss-Prot |
| Function | Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the effect of cognate toxin ParE4, but no other RelE or ParE toxin. {ECO:0000269|Pubmed:20487277}. |
| Pubmed ID | 11259647 15718296 20487277 |
| Domain | CDD:419885,CDD:425357 |
| Functional Category | Antitoxin_type_2 |
| Uniprot ID | Q9A458 |
| ORF Length (Amino Acid) | 96 |
++ More..
| Conservation Analysis |
No. of Species: 32
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3228577 | 3228867 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 3355797 | 3356030 | - | NC_007406.1 | Nitrobacter winogradskyi Nb-255 |
| 3 | 2471826 | 2472059 | - | NZ_CP050296.1 | Mesorhizobium huakuii |
| 4 | 2019092 | 2019343 | + | NZ_CP071454.1 | Rhizobium lentis |
| 5 | 1558571 | 1558816 | - | NZ_HG938354.1 | Neorhizobium galegae bv. orientalis str. HAMBI 540 |
| 6 | 1149293 | 1149526 | + | NC_009719.1 | Parvibaculum lavamentivorans DS-1 |
| 7 | 3961545 | 3961799 | - | NZ_CP033507.1 | Mesorhizobium jarvisii |
| 8 | 1095633 | 1095887 | + | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
| 9 | 61351 | 61593 | - | NZ_AP017655.1 | Sphingobium cloacae |
| 10 | 1498053 | 1498289 | + | NZ_CP061205.1 | Kordiimonas pumila |
| 11 | 2433584 | 2433832 | - | NZ_CP042304.1 | Devosia ginsengisoli |
| 12 | 4454542 | 4454784 | - | NZ_CP024201.1 | Caulobacter mirabilis |
| 13 | 225672 | 225926 | + | NZ_CP015322.1 | Mesorhizobium amorphae CCNWGS0123 |
| 14 | 913734 | 913982 | + | NZ_CP015882.1 | Ensifer adhaerens |
| 15 | 1298468 | 1298710 | - | NZ_CP059897.1 | Ciceribacter thiooxidans |
| 16 | 505634 | 505867 | - | NZ_CP071681.1 | Rhizobium ruizarguesonis |
| 17 | 448701 | 448937 | + | NZ_CP053923.1 | Defluviicoccus vanus |
| 18 | 912462 | 912695 | - | NZ_CP054022.1 | Rhizobium indicum |
| 19 | 389426 | 389662 | + | NZ_CP009292.1 | Novosphingobium pentaromativorans US6-1 |
| 20 | 441558 | 441848 | + | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 21 | 2285288 | 2285533 | - | NZ_CP022048.2 | Brevundimonas vesicularis |
| 22 | 601634 | 601870 | + | NC_019902.2 | Thioalkalivibrio nitratireducens DSM 14787 |
| 23 | 3276591 | 3276833 | - | NC_017956.1 | Tistrella mobilis KA081020-065 |
| 24 | 908572 | 908826 | - | NZ_CP046908.1 | Stappia indica |
| 25 | 444049 | 444300 | + | NZ_CP053856.1 | Rhizobium pusense |
| 26 | 1193785 | 1194030 | - | NZ_CP018911.1 | Glycocaulis alkaliphilus |
| 27 | 3510285 | 3510539 | + | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 28 | 3558202 | 3558456 | + | NZ_CP050139.1 | Komagataeibacter rhaeticus |
| 29 | 3451602 | 3451841 | - | NZ_CP012154.1 | Wenzhouxiangella marina |
| 30 | 1162885 | 1163127 | + | NZ_CP014476.1 | Methylomonas denitrificans |
| 31 | 59895 | 60131 | - | NC_023136.1 | Leisingera methylohalidivorans DSM 14336 |
| 32 | 11567 | 11803 | - | NZ_CP041164.1 | Leisingera aquaemixtae |
| 33 | 17720 | 17962 | + | NZ_CP040759.1 | Paracoccus liaowanqingii |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF05016.17 | 0.78 | 25 | -3 | same-strand | ParE toxin of type II toxin-antitoxin system, parDE |
++ More..