Result : Q9A2W1
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | ATP synthase epsilon chain (ATP synthase F1 sector epsilon subunit) (F-ATPase epsilon subunit) |
| NCBI Accession ID | AE005673.1 |
| Organism | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) |
| Left | 3688027 |
| Right | 3688287 |
| Strand | - |
| Nucleotide Sequence | ATGGCCAAGCTGCACTTCTCTCTGGTCGCCCCCGAGCGTGAACTGTTCTCGGGCGAGGTGGACATGGTCCAGGCTCCGGGCGCCGAAGGCGACTTCGGCGTGCTGGCCAACCACGCGCCGTTCATGACCACCCTGCGCGAAGGCAAGGTGACGGTGAAGGACGGCGCGACCACCAAGGTGTTCGACATCCAGGGCGGCTTCGCGGACGTTGGTCCCGAAGGCCTCACCATCCTGGCGGAGCACGCCGTCGAAGCGGCCTGA |
| Sequence | MAKLHFSLVAPERELFSGEVDMVQAPGAEGDFGVLANHAPFMTTLREGKVTVKDGATTKVFDIQGGFADVGPEGLTILAEHAVEAA |
| Source of smORF | Swiss-Prot |
| Function | Produces ATP from ADP in the presence of a proton gradient across the membrane. {ECO:0000250}. |
| Pubmed ID | 11259647 |
| Domain | CDD:421925 |
| Functional Category | Others |
| Uniprot ID | Q9A2W1 |
| ORF Length (Amino Acid) | 86 |
++ More..
| Conservation Analysis |
No. of Species: 58
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3714018 | 3714278 | - | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 262782 | 263042 | + | NZ_CP027850.1 | Caulobacter segnis |
| 3 | 3432849 | 3433109 | - | NZ_CP013002.1 | Caulobacter henricii |
| 4 | 353218 | 353478 | + | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 5 | 795792 | 796055 | - | NZ_CP026100.1 | Caulobacter flavus |
| 6 | 340358 | 340573 | + | NZ_CP024201.1 | Caulobacter mirabilis |
| 7 | 158567 | 158836 | + | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 8 | 241957 | 242220 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 9 | 157255 | 157515 | + | NZ_CP029479.1 | Phenylobacterium parvum |
| 10 | 1327675 | 1327884 | - | NZ_CP022048.2 | Brevundimonas vesicularis |
| 11 | 123168 | 123377 | + | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 12 | 294991 | 295239 | + | NC_014816.1 | Asticcacaulis excentricus CB 48 |
| 13 | 678245 | 678508 | + | NC_009511.1 | Sphingomonas wittichii RW1 |
| 14 | 3648678 | 3648929 | + | NZ_CP035765.1 | Sphingomonas paucimobilis |
| 15 | 2486871 | 2487134 | - | NZ_CP023449.1 | Rhizorhabdus dicambivorans |
| 16 | 710957 | 711178 | + | NZ_CP045434.1 | Sphingomonas ginsengisoli An et al. 2013 |
| 17 | 1253390 | 1253647 | - | NZ_CP015963.1 | Altererythrobacter ishigakiensis |
| 18 | 2566514 | 2566771 | + | NZ_CP031357.1 | Erythrobacter aureus |
| 19 | 481630 | 481887 | + | NZ_CP053921.1 | Erythrobacter mangrovi |
| 20 | 391787 | 392047 | + | NZ_CP041659.1 | Sphingomonas xanthus |
| 21 | 1140138 | 1140395 | - | NZ_CP017057.1 | Erythrobacter litoralis |
| 22 | 1803072 | 1803308 | - | NZ_CP016591.1 | Tsuneonella dongtanensis |
| 23 | 633257 | 633508 | + | NZ_CP024920.1 | Qipengyuania seohaensis |
| 24 | 1843746 | 1843985 | - | NZ_CP006644.1 | Sphingomonas sanxanigenens DSM 19645 = NX02 |
| 25 | 1619777 | 1620034 | + | NZ_CP012669.1 | Altererythrobacter epoxidivorans |
| 26 | 2616849 | 2617100 | + | NZ_CP023705.1 | Sphingomonas melonis |
| 27 | 572082 | 572336 | - | NZ_CP010836.1 | Sphingomonas hengshuiensis |
| 28 | 938289 | 938522 | + | NZ_CP020538.1 | Sphingobium herbicidovorans |
| 29 | 1179688 | 1179945 | + | NZ_CP051131.1 | Parasphingopyxis algicola |
| 30 | 2414180 | 2414437 | + | NC_008048.1 | Sphingopyxis alaskensis RB2256 |
| 31 | 2695149 | 2695382 | + | NC_014006.1 | Sphingobium japonicum UT26S |
| 32 | 1125141 | 1125407 | - | NZ_CP060718.1 | Sphingomonas lutea |
| 33 | 2686421 | 2686654 | - | NZ_AP017655.1 | Sphingobium cloacae |
| 34 | 2973020 | 2973277 | + | NZ_CP042345.1 | Novosphingobium ginsenosidimutans |
| 35 | 2239209 | 2239466 | + | NZ_CP011310.1 | Aurantiacibacter atlanticus |
| 36 | 353554 | 353787 | - | NZ_CP060035.1 | Sphingobium fuliginis |
| 37 | 769073 | 769333 | - | NZ_CP060782.1 | Sphingomonas sediminicola |
| 38 | 1578256 | 1578492 | + | NZ_CP011805.1 | Pelagerythrobacter marensis |
| 39 | 2571481 | 2571717 | + | NC_007794.1 | Novosphingobium aromaticivorans DSM 12444 |
| 40 | 918526 | 918783 | + | NZ_CP022889.1 | Tsuneonella mangrovi |
| 41 | 2276747 | 2276998 | - | NZ_CP009571.1 | Sphingomonas taxi |
| 42 | 2347541 | 2347798 | + | NZ_AP019389.1 | Qipengyuania flava |
| 43 | 1237249 | 1237506 | - | NZ_CP016545.1 | Paraurantiacibacter namhicola |
| 44 | 106405 | 106662 | + | NZ_CP016033.1 | Erythrobacter neustonensis |
| 45 | 317374 | 317610 | - | NZ_CP037948.1 | Qipengyuania sediminis |
| 46 | 3881609 | 3881866 | + | NZ_CP009429.1 | Sphingopyxis macrogoltabida |
| 47 | 2711777 | 2712028 | + | NZ_CP042306.1 | Sphingomonas panacisoli |
| 48 | 95660 | 95917 | + | NZ_CP034179.1 | Caenibius tardaugens NBRC 16725 |
| 49 | 591607 | 591867 | - | NZ_CP060717.1 | Sphingomonas rhizophila |
| 50 | 1979278 | 1979511 | - | NZ_CP022745.1 | Sphingobium xenophagum |
| 51 | 1001485 | 1001742 | + | NZ_CP011452.2 | Croceibacterium atlanticum |
| 52 | 2674927 | 2675178 | - | NZ_CP014168.1 | Sphingomonas panacis |
| 53 | 3927079 | 3927336 | + | NZ_CP009122.1 | Sphingopyxis fribergensis |
| 54 | 109756 | 110016 | + | NZ_CP060780.1 | Sphingomonas daechungensis |
| 55 | 1267597 | 1267854 | - | NZ_CP060052.1 | Croceicoccus marinus |
| 56 | 3632469 | 3632726 | + | NZ_CP020083.1 | Blastomonas fulva |
| 57 | 568263 | 568520 | - | NZ_CP009291.1 | Novosphingobium pentaromativorans US6-1 |
| 58 | 2766300 | 2766551 | + | NZ_CP053015.1 | Sphingomonas lacunae |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00006.27 | 1.0 | 58 | 2368 | same-strand | ATP synthase alpha/beta family, nucleotide-binding domain |
| 2 | PF02874.25 | 1.0 | 58 | 1663.0 | same-strand | ATP synthase alpha/beta family, beta-barrel domain |
| 3 | PF00231.21 | 1.0 | 58 | 1664.5 | same-strand | ATP synthase |
| 4 | PF00306.29 | 1.0 | 58 | 2638.5 | same-strand | ATP synthase alpha/beta chain, C terminal domain |
| 5 | PF00213.20 | 0.88 | 51 | 4156 | same-strand | ATP synthase delta (OSCP) subunit |
++ More..