Result : Q9A2E3
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0235 protein CC_3622 |
| NCBI Accession ID | AE005673.1 |
| Organism | Caulobacter vibrioides (strain ATCC 19089 / CB15) (Caulobacter crescentus) |
| Left | 3880956 |
| Right | 3881252 |
| Strand | + |
| Nucleotide Sequence | TTGGCTGACGGCGTGGCGGTGACGCTCGTGGTGCGCCTGACCCCGAGGGGCGGGCGAGACGCCGCCGAGGGTTGGGCGCTTGACGCCGACGGCCGCCTCTATCTGAAGGTGAGGGTCGCCAGTCCGCCCGTCGAGGGCGCGGCGAATGCGGCCCTCATCGCCTTTCTGGCAAAGACCCTGAAGATTCCTCGCTCGGCCGTACGACTGGCGGCTGGCGAAACCGCGCGGCTAAAGCGTCTCGAACTGGAGGGCGTGGACCCAGCCGATGTCGCACGCGCGTTCGGGCCGCCGAACTAG |
| Sequence | MADGVAVTLVVRLTPRGGRDAAEGWALDADGRLYLKVRVASPPVEGAANAALIAFLAKTLKIPRSAVRLAAGETARLKRLELEGVDPADVARAFGPPN |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00811. Profile Description: Uncharacterized ACR, YggU family COG1872. hypothetical protein; Validated |
| Pubmed ID | 11259647 |
| Domain | CDD:412584 |
| Functional Category | Others |
| Uniprot ID | Q9A2E3 |
| ORF Length (Amino Acid) | 98 |
++ More..
| Conservation Analysis |
No. of Species: 55
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3906938 | 3907234 | + | NC_011916.1 | Caulobacter vibrioides NA1000 |
| 2 | 4504912 | 4505196 | + | NZ_CP027850.1 | Caulobacter segnis |
| 3 | 3456662 | 3456940 | - | NZ_CP013002.1 | Caulobacter henricii |
| 4 | 3292685 | 3292966 | + | NZ_CP003811.1 | Methylobacterium oryzae CBMB20 |
| 5 | 314125 | 314436 | - | NZ_CP048815.1 | Caulobacter rhizosphaerae |
| 6 | 3049793 | 3050074 | + | NC_010505.1 | Methylobacterium radiotolerans JCM 2831 |
| 7 | 2503386 | 2503667 | + | NZ_CP015367.1 | Methylobacterium phyllosphaerae |
| 8 | 20325 | 20606 | + | NZ_CP043538.1 | Methylobacterium mesophilicum SR1.6/6 |
| 9 | 755803 | 756057 | + | NC_014816.1 | Asticcacaulis excentricus CB 48 |
| 10 | 929922 | 930185 | - | NZ_CP026100.1 | Caulobacter flavus |
| 11 | 98205 | 98489 | + | NZ_CP024201.1 | Caulobacter mirabilis |
| 12 | 1768651 | 1768974 | + | NZ_CP021112.1 | Pseudorhodoplanes sinuspersici |
| 13 | 4235722 | 4236000 | + | NZ_CP013500.1 | Rhizobium esperanzae |
| 14 | 3840596 | 3840856 | + | NC_011144.1 | Phenylobacterium zucineum HLK1 |
| 15 | 2171463 | 2171747 | - | NZ_CP039546.1 | Methylorubrum populi |
| 16 | 3437485 | 3437754 | + | NZ_CP015880.1 | Ensifer adhaerens |
| 17 | 1568020 | 1568331 | + | NZ_CP071454.1 | Rhizobium lentis |
| 18 | 4131963 | 4132229 | + | NZ_CP071612.1 | Rhizobium bangladeshense |
| 19 | 2435024 | 2435335 | - | NZ_CP048632.1 | Rhizobium oryzihabitans |
| 20 | 182419 | 182700 | + | NZ_LR588407.1 | Brevundimonas vancanneytii |
| 21 | 4059297 | 4059608 | + | NZ_CP020906.1 | Rhizobium etli |
| 22 | 4284642 | 4284953 | + | NZ_CP013532.1 | Rhizobium phaseoli |
| 23 | 3579331 | 3579654 | - | NZ_CP044331.1 | Methylocystis parvus |
| 24 | 2405144 | 2405455 | + | NZ_CP061003.1 | Agrobacterium tumefaciens |
| 25 | 3435032 | 3435346 | + | NC_020059.1 | Rhizobium tropici CIAT 899 |
| 26 | 4264537 | 4264848 | + | NZ_CP071604.1 | Rhizobium binae |
| 27 | 4092777 | 4093058 | + | NZ_CP032694.1 | Rhizobium jaguaris |
| 28 | 3887260 | 3887571 | + | NZ_CP034998.1 | Rhizobium acidisoli |
| 29 | 4062005 | 4062286 | + | NZ_CP041238.1 | Ensifer mexicanus |
| 30 | 3927097 | 3927408 | - | NC_011666.1 | Methylocella silvestris BL2 |
| 31 | 97221 | 97544 | - | NZ_CP018171.1 | Mesorhizobium oceanicum |
| 32 | 4758234 | 4758536 | + | NZ_CP071678.1 | Rhizobium ruizarguesonis |
| 33 | 1457385 | 1457648 | - | NZ_CP006644.1 | Sphingomonas sanxanigenens DSM 19645 = NX02 |
| 34 | 2562004 | 2562249 | - | NZ_CP050296.1 | Mesorhizobium huakuii |
| 35 | 3549954 | 3550229 | + | NZ_CP013107.1 | Sinorhizobium americanum |
| 36 | 6222471 | 6222734 | + | NC_017030.1 | Corallococcus coralloides DSM 2259 |
| 37 | 2972655 | 2972927 | + | NZ_CP016616.1 | Microvirga ossetica |
| 38 | 678071 | 678331 | + | NZ_CP040818.1 | Paraoceanicella profunda |
| 39 | 3141428 | 3141697 | - | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 40 | 1861139 | 1861402 | + | NC_013523.1 | Sphaerobacter thermophilus DSM 20745 |
| 41 | 3025728 | 3025982 | + | NZ_CP009571.1 | Sphingomonas taxi |
| 42 | 1718852 | 1719115 | + | NZ_CP042430.1 | Baekduia soli |
| 43 | 3720420 | 3720689 | - | NC_011894.1 | Methylobacterium nodulans ORS 2060 |
| 44 | 2961107 | 2961379 | + | NZ_CP029550.1 | Methylobacterium durans |
| 45 | 517723 | 518037 | + | NZ_CP045423.1 | Microvirga thermotolerans |
| 46 | 3841068 | 3841340 | + | NC_009937.1 | Azorhizobium caulinodans ORS 571 |
| 47 | 123515 | 123838 | - | NZ_CP019948.1 | Methylocystis bryophila |
| 48 | 1849124 | 1849390 | + | NZ_CP025086.1 | Methylovirgula ligni |
| 49 | 135989 | 136246 | - | NC_014375.1 | Brevundimonas subvibrioides ATCC 15264 |
| 50 | 1186866 | 1187108 | + | NC_015675.1 | Mesorhizobium opportunistum WSM2075 |
| 51 | 3600169 | 3600438 | - | NZ_CP029451.1 | Sinorhizobium fredii CCBAU 25509 |
| 52 | 609045 | 609356 | - | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 53 | 990555 | 990824 | - | NZ_CP041636.1 | Ferrovibrio terrae |
| 54 | 3724335 | 3724601 | + | NZ_AP018907.1 | Blastochloris tepida |
| 55 | 3339953 | 3340276 | - | NZ_CP012946.1 | Blastochloris viridis |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_011916.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF02325.19 | 0.78 | 43 | 21 | same-strand | YGGT family |
++ More..