Result : Q99165

Protein Information

• Protein name: Uncharacterized 9.5 kDa protein in ORF3 5'region
• NCBI Accession ID: M63942.1
• Organism: Bacillus licheniformis
• Left: 669
• Right: 932
• Strand: +
• Nucleotide Sequence: ATGAAACATATCGACAAAGGCACGGTCGTCAGGACGGTGCTTCTTTTTATTGCGCTGGTCAATCAGACGTTGATCATGTTTGGAAAGCCGGTTTTGCCGGTCGCTGAAGATCAGATTCATACATTGGCGGATGCCCTGTATTCGGCCGGATCTGCGGCTTTTACGATCGCTGCATCGCTCGTTGCCTGGTATAAGAACAACTATGTGACGAGCAAAGGGAAAATGCAAAAAGAAGTTTTACAGAAAAAAGGTTTAACGAAATAA
• Sequence: MKHIDKGTVVRTVLLFIALVNQTLIMFGKPVLPVAEDQIHTLADALYSAGSAAFTIAASLVAWYKNNYVTSKGKMQKEVLQKKGLTK
• Source of smORF: Swiss-Prot
• Function: The ORF matches to the profile of cl23882. Profile Description: SPP1 phage holin. This model represents one of more than 30 families of phage proteins, all lacking detectable homology with each other, known or believed to act as holins. Holins act in cell lysis by bacteriophage. Members of this family are found in phage PBSX and phage SPP1, among others. [Mobile and extrachromosomal element functions, Prophage functions]
• Pubmed ID: 2033382
• Domain: CDD:420075
• Functional Category: Others
• Uniprot ID: Q99165
• ORF Length (Amino Acid): 87

Conservation Analysis

No. of Species: 17

Sr.No.	Left Position	Right Position	Strand	NCBI Accession id	Species Name
1	1344033	1344296	+	NC_006270.3	Bacillus licheniformis DSM 13 = ATCC 14580
2	3433370	3433633	-	NC_006270.3	Bacillus licheniformis DSM 13 = ATCC 14580
3	1459866	1460129	+	NC_006270.3	Bacillus licheniformis DSM 13 = ATCC 14580
4	1445977	1446240	+	NZ_CP023665.1	Bacillus paralicheniformis
5	3369076	3369339	-	NZ_CP023665.1	Bacillus paralicheniformis
6	1402378	1402641	+	NZ_CP023665.1	Bacillus paralicheniformis
7	3208457	3208720	-	NZ_LT603683.1	Bacillus glycinifermentans
8	3841512	3841775	-	NZ_LT603683.1	Bacillus glycinifermentans
9	1375193	1375456	+	NZ_LT603683.1	Bacillus glycinifermentans
10	2611933	2612196	+	NZ_CP017786.1	Bacillus xiamenensis
11	1001092	1001355	-	NZ_CP017786.1	Bacillus xiamenensis
12	1204518	1204781	+	NZ_CP011150.1	Bacillus altitudinis
13	2791390	2791653	-	NZ_CP011150.1	Bacillus altitudinis
14	2519368	2519631	+	NZ_CP043404.1	Bacillus safensis
15	1347013	1347276	+	NC_000964.3	Bacillus subtilis subsp. subtilis str. 168
16	1316862	1317125	+	NZ_CP034943.1	Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499
17	1969589	1969852	-	NZ_CP034943.1	Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499
18	1263080	1263343	+	NZ_CP048852.1	Bacillus tequilensis
19	1320417	1320680	+	NZ_CP013984.1	Bacillus inaquosorum
20	2703184	2703447	-	NZ_CP013984.1	Bacillus inaquosorum
21	638694	638957	-	NZ_CP029364.1	Bacillus halotolerans
22	1355754	1356017	+	NZ_CP051464.1	Bacillus mojavensis
23	1516038	1516301	+	NZ_CP033052.1	Bacillus vallismortis
24	2810394	2810663	+	NZ_CP053989.1	Niallia circulans
25	2441333	2441566	+	NZ_CP009709.1	Weizmannia coagulans DSM 1 = ATCC 7050
26	2498652	2498885	+	NZ_CP009709.1	Weizmannia coagulans DSM 1 = ATCC 7050
27	2691078	2691341	-	NZ_CP011937.1	Bacillus velezensis
28	1269912	1270175	+	NZ_CP053376.1	Bacillus amyloliquefaciens

Neighborhood Conservation Analysis

^* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
^* 'Small ORF' represents the entry/query analyzed.
^* Image generated using 'gggenes'(R-Package).

Neighborhood Representative Chosen(Species): NC_000964.3

Sr.No.	Domain	Co-occurrence Frequency	No. of species in which domain occurs with smORF	Median distance b/w smORF and domain bearing ORFs	Orientation relative to smORF	PFAM Information
1	PF10779.11	0.76	13	15.0	same-strand	Haemolysin XhlA
2	PF01471.20	0.88	15	40	same-strand	Putative peptidoglycan binding domain
3	PF01510.27	0.82	14	20	same-strand	N-acetylmuramoyl-L-alanine amidase
4	PF09693.12	0.71	12	365.5	same-strand	Phage uncharacterised protein (Phage XkdX)
5	PF01476.22	0.71	12	14	same-strand	LysM domain