Protein Information |
Information Type | Description |
---|---|
Protein name | Nucleoid-associated protein MYPU_0500 |
NCBI Accession ID | AL445563.1 |
Organism | Mycoplasma pulmonis (strain UAB CTIP) |
Left | 55738 |
Right | 56040 |
Strand | + |
Nucleotide Sequence | GTGAATAATATGAATATAAATGAAATGTTAAAACAAGCTAAAAAAATGCAAAGTGAAATTGAGCTTAAGGAAAAAGAGCTTTATAAAAAAGAGTTTACAATTGAAAAACAAGGGCTAACTCTTGTATTAAATGGTAAAAGAGAAGTTTTAAAAATTGATATTAATGAAGCATTAGTTGATCCAGAGGATAAAGACATCCTAGAGGATTTATTGCTTTTAGCTTTTAATGAAGCTATGGAAAAAATTGATGAGGCTCACAAGGAAATTGAAAAGCAAATTCCAAGTGGTAAATTGCCATTTTAA |
Sequence | MNNMNINEMLKQAKKMQSEIELKEKELYKKEFTIEKQGLTLVLNGKREVLKIDINEALVDPEDKDILEDLLLLAFNEAMEKIDEAHKEIEKQIPSGKLPF |
Source of smORF | Swiss-Prot |
Function | Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection. {ECO:0000255|HAMAP-Rule:MF_00274}. |
Pubmed ID | 11353084 |
Domain | CDD:412410 |
Functional Category | DNA-binding |
Uniprot ID | Q98RF9 |
ORF Length (Amino Acid) | 100 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 55738 | 56040 | + | NC_002771.1 | Mycoplasmopsis pulmonis UAB CTIP |
2 | 560226 | 560519 | - | NZ_CP030103.1 | Mycoplasma cloacale |
3 | 154431 | 154724 | - | NZ_CP030140.1 | Mycoplasma anseris |
4 | 133883 | 134128 | + | NZ_CP055143.1 | Mycoplasma hominis |
5 | 589937 | 590230 | + | NZ_AP014657.1 | Mycoplasmopsis arginini |
6 | 1167657 | 1167899 | - | NZ_LR215036.1 | Mycoplasmopsis citelli |
7 | 153310 | 153597 | + | NZ_LR215047.1 | Mycoplasma arthritidis |
8 | 240407 | 240658 | - | NZ_LR214938.2 | Mycoplasma salivarium |
9 | 462807 | 463061 | - | NZ_LR215039.1 | Mycoplasmopsis columboralis |
10 | 97106 | 97393 | + | NC_006908.1 | Mycoplasma mobile 163K |
11 | 675625 | 675870 | - | NZ_AP022325.1 | Mycoplasmopsis felis |
12 | 22990 | 23232 | + | NZ_LR215024.1 | Mycoplasmopsis glycophila |
13 | 876886 | 877140 | - | NC_014014.1 | Mycoplasma crocodyli MP145 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF13177.8 | 1.0 | 13 | 1228 | same-strand | DNA polymerase III, delta subunit |
2 | PF00004.31 | 1.0 | 13 | 1118 | same-strand | ATPase family associated with various cellular activities (AAA) |
3 | PF02132.17 | 0.85 | 11 | 2 | same-strand | RecR protein |
4 | PF00590.22 | 0.62 | 8 | 2130.0 | same-strand | Tetrapyrrole (Corrin/Porphyrin) Methylases |
5 | PF13662.8 | 0.77 | 10 | 1.0 | same-strand | Toprim domain |
6 | PF13401.8 | 0.69 | 9 | 1113 | same-strand | AAA domain |