Result : Q98RF9
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Nucleoid-associated protein MYPU_0500 |
| NCBI Accession ID | AL445563.1 |
| Organism | Mycoplasma pulmonis (strain UAB CTIP) |
| Left | 55738 |
| Right | 56040 |
| Strand | + |
| Nucleotide Sequence | GTGAATAATATGAATATAAATGAAATGTTAAAACAAGCTAAAAAAATGCAAAGTGAAATTGAGCTTAAGGAAAAAGAGCTTTATAAAAAAGAGTTTACAATTGAAAAACAAGGGCTAACTCTTGTATTAAATGGTAAAAGAGAAGTTTTAAAAATTGATATTAATGAAGCATTAGTTGATCCAGAGGATAAAGACATCCTAGAGGATTTATTGCTTTTAGCTTTTAATGAAGCTATGGAAAAAATTGATGAGGCTCACAAGGAAATTGAAAAGCAAATTCCAAGTGGTAAATTGCCATTTTAA |
| Sequence | MNNMNINEMLKQAKKMQSEIELKEKELYKKEFTIEKQGLTLVLNGKREVLKIDINEALVDPEDKDILEDLLLLAFNEAMEKIDEAHKEIEKQIPSGKLPF |
| Source of smORF | Swiss-Prot |
| Function | Binds to DNA and alters its conformation. May be involved in regulation of gene expression, nucleoid organization and DNA protection. {ECO:0000255|HAMAP-Rule:MF_00274}. |
| Pubmed ID | 11353084 |
| Domain | CDD:412410 |
| Functional Category | DNA-binding |
| Uniprot ID | Q98RF9 |
| ORF Length (Amino Acid) | 100 |
++ More..
| Conservation Analysis |
No. of Species: 13
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 55738 | 56040 | + | NC_002771.1 | Mycoplasmopsis pulmonis UAB CTIP |
| 2 | 560226 | 560519 | - | NZ_CP030103.1 | Mycoplasma cloacale |
| 3 | 154431 | 154724 | - | NZ_CP030140.1 | Mycoplasma anseris |
| 4 | 133883 | 134128 | + | NZ_CP055143.1 | Mycoplasma hominis |
| 5 | 589937 | 590230 | + | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 6 | 1167657 | 1167899 | - | NZ_LR215036.1 | Mycoplasmopsis citelli |
| 7 | 153310 | 153597 | + | NZ_LR215047.1 | Mycoplasma arthritidis |
| 8 | 240407 | 240658 | - | NZ_LR214938.2 | Mycoplasma salivarium |
| 9 | 462807 | 463061 | - | NZ_LR215039.1 | Mycoplasmopsis columboralis |
| 10 | 97106 | 97393 | + | NC_006908.1 | Mycoplasma mobile 163K |
| 11 | 675625 | 675870 | - | NZ_AP022325.1 | Mycoplasmopsis felis |
| 12 | 22990 | 23232 | + | NZ_LR215024.1 | Mycoplasmopsis glycophila |
| 13 | 876886 | 877140 | - | NC_014014.1 | Mycoplasma crocodyli MP145 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP030103.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF13177.8 | 1.0 | 13 | 1228 | same-strand | DNA polymerase III, delta subunit |
| 2 | PF00004.31 | 1.0 | 13 | 1118 | same-strand | ATPase family associated with various cellular activities (AAA) |
| 3 | PF02132.17 | 0.85 | 11 | 2 | same-strand | RecR protein |
| 4 | PF00590.22 | 0.62 | 8 | 2130.0 | same-strand | Tetrapyrrole (Corrin/Porphyrin) Methylases |
| 5 | PF13662.8 | 0.77 | 10 | 1.0 | same-strand | Toprim domain |
| 6 | PF13401.8 | 0.69 | 9 | 1113 | same-strand | AAA domain |
++ More..