Result : A9KPG4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | Putative regulatory protein Cphy_2880 |
| NCBI Accession ID | CP000885.1 |
| Organism | Lachnoclostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) (Clostridium phytofermentans) |
| Left | 3531687 |
| Right | 3531962 |
| Strand | - |
| Nucleotide Sequence | TTGAATAAACTGATTAATATTGGTTTTGGTAATGTAGTAAATGCAGGTAAGATAATTTCTGTAATACGGCCGGAGGCAGCTCCGGTAAAAAGAATGGTTCAAAATGCAAAAGATAGCGGCAGCTGTGTGGATGCAACTTGTGGAAGAAAATGCAAAGCAGTTGTTGTTATGGAAACTGGACAGATTGTGTTGTCAGCATTGCTTCCCGAGACAATTGCAAATCGTGTGAACCAACGAGAGAGCATAGAAAGCAATGAAGTTTTCCAAGCTCTATAA |
| Sequence | MNKLINIGFGNVVNAGKIISVIRPEAAPVKRMVQNAKDSGSCVDATCGRKCKAVVVMETGQIVLSALLPETIANRVNQRESIESNEVFQAL |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl00898. Profile Description: Domain of unknown function (DUF370). hypothetical protein; Provisional |
| Pubmed ID | |
| Domain | CDD:412637 |
| Functional Category | Others |
| Uniprot ID | A9KPG4 |
| ORF Length (Amino Acid) | 91 |
++ More..
| Conservation Analysis |
No. of Species: 123
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 3531687 | 3531962 | - | NC_010001.1 | Lachnoclostridium phytofermentans ISDg |
| 2 | 3517923 | 3518195 | + | NZ_CP048000.1 | Anaerocolumna sedimenticola |
| 3 | 2921612 | 2921887 | - | NZ_AP023367.1 | Anaerocolumna cellulosilytica |
| 4 | 1106292 | 1106570 | + | NZ_LN879430.1 | Herbinix luporum |
| 5 | 2116318 | 2116581 | + | NZ_CP053989.1 | Niallia circulans |
| 6 | 4996432 | 4996656 | - | NZ_CP041305.1 | Cytobacillus ciccensis |
| 7 | 1720969 | 1721193 | + | NC_022524.1 | Bacillus infantis NRRL B-14911 |
| 8 | 2023523 | 2023786 | + | NZ_CP042593.1 | Bacillus dafuensis |
| 9 | 1211050 | 1211283 | - | NZ_LR778174.1 | Veillonella parvula |
| 10 | 1321116 | 1321376 | + | NZ_CP012024.1 | Bacillus smithii |
| 11 | 1108118 | 1108351 | - | NZ_AP022321.1 | Veillonella nakazawae |
| 12 | 1166253 | 1166486 | - | NZ_LR134375.1 | Veillonella dispar |
| 13 | 1877159 | 1877440 | + | NZ_CP022121.1 | Dehalobacterium formicoaceticum |
| 14 | 2364481 | 2364750 | - | NZ_CP011937.1 | Bacillus velezensis |
| 15 | 1820032 | 1820301 | + | NZ_CP033052.1 | Bacillus vallismortis |
| 16 | 1549069 | 1549338 | + | NZ_CP048852.1 | Bacillus tequilensis |
| 17 | 1596396 | 1596665 | + | NZ_CP053376.1 | Bacillus amyloliquefaciens |
| 18 | 1645750 | 1646019 | + | NZ_CP051464.1 | Bacillus mojavensis |
| 19 | 1608212 | 1608481 | + | NZ_CP034943.1 | Bacillus subtilis subsp. spizizenii ATCC 6633 = JCM 2499 |
| 20 | 1614542 | 1614811 | + | NZ_CP013984.1 | Bacillus inaquosorum |
| 21 | 344202 | 344471 | - | NZ_CP029364.1 | Bacillus halotolerans |
| 22 | 1641672 | 1641941 | + | NC_000964.3 | Bacillus subtilis subsp. subtilis str. 168 |
| 23 | 939691 | 939924 | + | NZ_LT906470.1 | Veillonella rodentium |
| 24 | 180531 | 180794 | - | NZ_CP022983.1 | Cytobacillus kochii |
| 25 | 106442 | 106699 | + | NZ_CP009709.1 | Weizmannia coagulans DSM 1 = ATCC 7050 |
| 26 | 3117834 | 3118106 | - | NZ_CP039126.1 | Blautia producta |
| 27 | 1747484 | 1747753 | + | NC_006270.3 | Bacillus licheniformis DSM 13 = ATCC 14580 |
| 28 | 1770086 | 1770355 | + | NZ_CP023665.1 | Bacillus paralicheniformis |
| 29 | 2604584 | 2604847 | - | NZ_CP065425.1 | Heyndrickxia vini |
| 30 | 155484 | 155741 | - | NZ_CP017786.1 | Bacillus xiamenensis |
| 31 | 1543728 | 1543985 | + | NZ_CP011150.1 | Bacillus altitudinis |
| 32 | 3775193 | 3775450 | - | NZ_CP043404.1 | Bacillus safensis |
| 33 | 1455588 | 1455854 | - | NC_018870.1 | Thermacetogenium phaeum DSM 12270 |
| 34 | 1329633 | 1329896 | - | NC_007503.1 | Carboxydothermus hydrogenoformans Z-2901 |
| 35 | 844037 | 844273 | + | NZ_CP017237.1 | Moorella thermoacetica |
| 36 | 2405657 | 2405920 | - | NZ_CP016020.1 | Bacillus weihaiensis |
| 37 | 1581410 | 1581658 | + | NZ_AP019004.1 | Phascolarctobacterium faecium |
| 38 | 3427076 | 3427339 | - | NZ_CP017703.1 | Aeribacillus pallidus |
| 39 | 3854449 | 3854724 | - | NC_018068.1 | Desulfosporosinus acidiphilus SJ4 |
| 40 | 330865 | 331104 | + | NZ_LT996885.1 | Dialister massiliensis |
| 41 | 2600791 | 2601054 | - | NZ_CP018866.1 | Sutcliffiella cohnii |
| 42 | 3946908 | 3947183 | - | NC_018515.1 | Desulfosporosinus meridiei DSM 13257 |
| 43 | 4942074 | 4942349 | - | NC_016584.1 | Desulfosporosinus orientis DSM 765 |
| 44 | 1570980 | 1571234 | - | NC_013740.1 | Acidaminococcus fermentans DSM 20731 |
| 45 | 676747 | 677010 | + | NC_015172.1 | Syntrophobotulus glycolicus DSM 8271 |
| 46 | 2480444 | 2480665 | + | NZ_CP026363.1 | Brevibacillus agri |
| 47 | 2275117 | 2275377 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 48 | 537813 | 538034 | - | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 49 | 2107469 | 2107741 | - | NZ_CP030280.1 | Blautia argi |
| 50 | 2335243 | 2335485 | - | NZ_CP048436.1 | Flavonifractor plautii |
| 51 | 1004699 | 1004968 | + | NC_014377.1 | Thermosediminibacter oceani DSM 16646 |
| 52 | 2807468 | 2807749 | - | NC_009633.1 | Alkaliphilus metalliredigens QYMF |
| 53 | 1765907 | 1766167 | - | NC_018664.1 | Gottschalkia acidurici 9a |
| 54 | 1515353 | 1515577 | + | NZ_CP009416.1 | Jeotgalibacillus malaysiensis |
| 55 | 1319093 | 1319365 | + | NZ_CP022413.2 | Blautia hansenii DSM 20583 |
| 56 | 1187409 | 1187669 | + | NC_006510.1 | Geobacillus kaustophilus HTA426 |
| 57 | 273287 | 273547 | + | NZ_CP061470.1 | Geobacillus zalihae |
| 58 | 2795236 | 2795496 | - | NZ_CP018058.1 | Geobacillus thermocatenulatus |
| 59 | 635258 | 635518 | + | NZ_CP061472.1 | Geobacillus thermoleovorans |
| 60 | 1146583 | 1146837 | + | NZ_CP035130.1 | Gudongella oleilytica |
| 61 | 2672055 | 2672315 | - | NZ_CP019659.1 | Paenibacillus larvae subsp. larvae |
| 62 | 1155680 | 1155946 | - | NZ_CP068564.1 | Keratinibaculum paraultunense |
| 63 | 1531239 | 1531508 | + | NC_009922.1 | Alkaliphilus oremlandii OhILAs |
| 64 | 2185931 | 2186191 | - | NZ_CP014342.1 | Geobacillus subterraneus |
| 65 | 2268102 | 2268323 | - | NC_019897.1 | Thermobacillus composti KWC4 |
| 66 | 2372551 | 2372814 | - | NC_013791.2 | Alkalihalobacillus pseudofirmus OF4 |
| 67 | 2258891 | 2259121 | + | NZ_CP059066.1 | Koleobacter methoxysyntrophicus |
| 68 | 1769518 | 1769787 | + | NZ_LT603683.1 | Bacillus glycinifermentans |
| 69 | 592555 | 592803 | + | NZ_LT906446.1 | Megamonas hypermegale |
| 70 | 1772866 | 1773090 | + | NZ_CP016622.1 | Parageobacillus thermoglucosidasius |
| 71 | 2820573 | 2820800 | - | NZ_CP070511.1 | Parageobacillus toebii |
| 72 | 1400120 | 1400347 | + | NZ_CP030777.1 | Faecalibacterium prausnitzii |
| 73 | 567146 | 567370 | - | NZ_CP021983.2 | Halomicronema hongdechloris C2206 |
| 74 | 3410332 | 3410598 | + | NZ_CP060822.1 | Cylindrospermopsis curvispora GIHE-G1 |
| 75 | 1202077 | 1202346 | - | NZ_CP016786.1 | Clostridium isatidis |
| 76 | 5549978 | 5550244 | - | NC_009925.1 | Acaryochloris marina MBIC11017 |
| 77 | 5543729 | 5543974 | - | NZ_AP014638.1 | Leptolyngbya boryana IAM M-101 |
| 78 | 1985698 | 1985949 | - | NC_014614.1 | Acetoanaerobium sticklandii |
| 79 | 1292213 | 1292473 | + | NZ_CP042326.1 | Euhalothece natronophila Z-M001 |
| 80 | 1826135 | 1826389 | - | NZ_CP024955.1 | Kyrpidia spormannii |
| 81 | 2020150 | 2020413 | - | NZ_CP012502.1 | Bacillus beveridgei |
| 82 | 1111249 | 1111503 | + | NC_014831.1 | Thermaerobacter marianensis DSM 12885 |
| 83 | 916204 | 916461 | - | NC_018024.1 | Acetomicrobium mobile DSM 13181 |
| 84 | 1126625 | 1126849 | + | NZ_HF545616.1 | Ruminococcus bicirculans |
| 85 | 1668547 | 1668798 | + | NC_019776.1 | Cyanobacterium aponinum PCC 10605 |
| 86 | 2456210 | 2456437 | - | NZ_CP020772.1 | Halobacillus mangrovi |
| 87 | 2319310 | 2319576 | - | NC_019748.1 | Stanieria cyanosphaera PCC 7437 |
| 88 | 2762956 | 2763219 | - | NC_014829.1 | Evansella cellulosilytica DSM 2522 |
| 89 | 1524274 | 1524534 | + | NZ_CP041666.1 | Radiobacillus deserti |
| 90 | 815516 | 815740 | + | NC_013522.1 | Thermanaerovibrio acidaminovorans DSM 6589 |
| 91 | 2616624 | 2616881 | - | NZ_CP024109.1 | Bacillus cytotoxicus |
| 92 | 1470916 | 1471173 | + | NZ_CP040336.1 | Bacillus luti |
| 93 | 3688770 | 3689027 | - | NC_007530.2 | Bacillus anthracis str. 'Ames Ancestor' |
| 94 | 3758324 | 3758581 | - | NZ_CP064875.1 | Bacillus toyonensis |
| 95 | 3893315 | 3893572 | - | NC_011725.1 | Bacillus cereus B4264 |
| 96 | 3897601 | 3897858 | - | NZ_CP032365.1 | Bacillus wiedmannii |
| 97 | 78218 | 78439 | + | NZ_CP029462.1 | Megasphaera stantonii |
| 98 | 1660369 | 1660617 | + | NZ_CP029797.1 | Paraliobacillus zengyii |
| 99 | 1294516 | 1294764 | - | NZ_CP068053.1 | Peribacillus psychrosaccharolyticus |
| 100 | 992098 | 992361 | - | NZ_CP017704.1 | Peribacillus simplex NBRC 15720 = DSM 1321 |
| 101 | 4188295 | 4188558 | + | NZ_CP030926.1 | Peribacillus butanolivorans |
| 102 | 1246888 | 1247136 | + | NZ_CP008876.1 | Terribacillus goriensis |
| 103 | 338208 | 338462 | + | NZ_CP013862.1 | Lentibacillus amyloliquefaciens |
| 104 | 1762977 | 1763231 | + | NZ_CP024848.1 | Oceanobacillus zhaokaii |
| 105 | 1477341 | 1477604 | - | NZ_CP011361.2 | Salimicrobium jeotgali |
| 106 | 2655184 | 2655444 | - | NZ_CP022437.1 | Virgibacillus necropolis |
| 107 | 1544870 | 1545130 | + | NC_004193.1 | Oceanobacillus iheyensis HTE831 |
| 108 | 1591712 | 1591972 | - | NC_018704.1 | Amphibacillus xylanus NBRC 15112 |
| 109 | 3310996 | 3311250 | - | NZ_CP022315.1 | Virgibacillus phasianinus |
| 110 | 313357 | 313605 | - | NZ_LS974202.1 | Mesotoga infera |
| 111 | 775520 | 775756 | + | NC_017934.1 | Mesotoga prima MesG1.Ag.4.2 |
| 112 | 2046619 | 2046888 | + | NZ_LR027880.1 | Roseburia intestinalis L1-82 |
| 113 | 1697175 | 1697450 | - | NC_009828.1 | Pseudothermotoga lettingae TMO |
| 114 | 1732230 | 1732505 | - | NC_022792.1 | Pseudothermotoga elfii DSM 9442 = NBRC 107921 |
| 115 | 1279143 | 1279418 | - | NZ_AP014510.1 | Thermotoga profunda AZM34c06 |
| 116 | 1461295 | 1461522 | - | NC_011661.1 | Dictyoglomus turgidum DSM 6724 |
| 117 | 1514878 | 1515102 | - | NZ_AP014509.1 | Thermotoga caldifontis AZM44c09 |
| 118 | 1548827 | 1549093 | + | NC_022795.1 | Pseudothermotoga hypogea DSM 11164 = NBRC 106472 |
| 119 | 1281042 | 1281269 | - | NC_011297.1 | Dictyoglomus thermophilum H-6-12 |
| 120 | 2075967 | 2076218 | - | NZ_CP038015.1 | Paenisporosarcina antarctica |
| 121 | 1625757 | 1626014 | + | NZ_CP015378.1 | Fictibacillus phosphorivorans |
| 122 | 1606260 | 1606529 | + | NZ_LR699011.1 | Roseburia hominis |
| 123 | 1550476 | 1550721 | - | NC_014378.1 | Acetohalobium arabaticum DSM 5501 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP053989.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF01192.24 | 0.93 | 115 | 628 | same-strand | RNA polymerase Rpb6 |
| 2 | PF03755.15 | 0.88 | 108 | 57.0 | same-strand | YicC-like family, N-terminal region |
| 3 | PF08340.13 | 0.88 | 108 | 57.0 | same-strand | Domain of unknown function (DUF1732) |
| 4 | PF05833.13 | 0.78 | 96 | 3829.0 | opposite-strand | NFACT N-terminal and middle domains |
| 5 | PF05670.15 | 0.78 | 96 | 3829.0 | opposite-strand | NFACT protein RNA binding domain |
| 6 | PF00625.23 | 0.93 | 115 | 10 | same-strand | Guanylate kinase |
| 7 | PF04127.17 | 0.8 | 99 | 911 | same-strand | DNA / pantothenate metabolism flavoprotein |
| 8 | PF02441.21 | 0.81 | 100 | 911.0 | same-strand | Flavoprotein |
| 9 | PF18074.3 | 0.71 | 87 | 2163 | same-strand | Primosomal protein N C-terminal domain |
| 10 | PF17764.3 | 0.72 | 89 | 2163 | same-strand | 3'DNA-binding domain (3'BD) |
| 11 | PF00270.31 | 0.69 | 85 | 2166 | same-strand | DEAD/DEAH box helicase |
| 12 | PF04851.17 | 0.69 | 85 | 2166 | same-strand | Type III restriction enzyme, res subunit |
| 13 | PF18319.3 | 0.71 | 87 | 2163 | same-strand | PriA DNA helicase Cys-rich region (CRR) domain |
++ More..