Result : Q98R70
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L31 |
| NCBI Accession ID | AL445563.1 |
| Organism | Mycoplasma pulmonis (strain UAB CTIP) |
| Left | 148881 |
| Right | 149090 |
| Strand | + |
| Nucleotide Sequence | ATGCAAAAGGACATTCATTTAAAAATGGAACCACTGAAGATTACATGTTCAACATGTTTTACTTCATTTGACATTGTTTCGTCAAGAAAAACAATAGCTATTGACATTTGTTCAAAATGTCACCCATTCTATACAGGAGATAGAACATTGGCTAAAGCAACTGGTCAAATCGATAAGTTCCAAAAAAGATTGCAAAAAAAGCAAAAATAA |
| Sequence | MQKDIHLKMEPLKITCSTCFTSFDIVSSRKTIAIDICSKCHPFYTGDRTLAKATGQIDKFQKRLQKKQK |
| Source of smORF | Swiss-Prot |
| Function | Binds the 23S rRNA. {ECO:0000255|HAMAP-Rule:MF_00501}. |
| Pubmed ID | 11353084 |
| Domain | CDD:412343 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q98R70 |
| ORF Length (Amino Acid) | 69 |
++ More..
| Conservation Analysis |
No. of Species: 21
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 148881 | 149090 | + | NC_002771.1 | Mycoplasmopsis pulmonis UAB CTIP |
| 2 | 184377 | 184586 | + | NZ_LR215039.1 | Mycoplasmopsis columboralis |
| 3 | 723087 | 723296 | - | NZ_CP030141.1 | Mycoplasmopsis anatis |
| 4 | 101600 | 101809 | - | NZ_LR215036.1 | Mycoplasmopsis citelli |
| 5 | 71685 | 71894 | - | NZ_CP011368.1 | Mycoplasmopsis canis |
| 6 | 581137 | 581346 | - | NZ_LR214986.1 | Mycoplasmopsis cynos |
| 7 | 792493 | 792702 | - | NZ_CP041664.1 | Mycoplasma anserisalpingitidis |
| 8 | 330652 | 330861 | + | NZ_LR215024.1 | Mycoplasmopsis glycophila |
| 9 | 238178 | 238387 | + | NZ_LS991951.1 | Mycoplasmopsis edwardii |
| 10 | 798434 | 798646 | + | NZ_CP034841.1 | Mycoplasmopsis phocirhinis |
| 11 | 292413 | 292622 | - | NZ_LR214950.1 | Mycoplasmopsis gallinacea |
| 12 | 565996 | 566205 | + | NZ_AP022325.1 | Mycoplasmopsis felis |
| 13 | 290269 | 290481 | - | NZ_LR215037.1 | Mycoplasmopsis maculosa |
| 14 | 737646 | 737855 | + | NZ_LR214951.1 | Mycoplasma neurolyticum |
| 15 | 840502 | 840711 | + | NZ_LR214972.1 | Mycoplasmopsis bovirhinis |
| 16 | 12086 | 12295 | - | NZ_LR215032.1 | Mycoplasmopsis gallopavonis |
| 17 | 643048 | 643260 | - | NC_009497.1 | Mycoplasmopsis agalactiae PG2 |
| 18 | 709375 | 709587 | - | NZ_CP005933.1 | Mycoplasmopsis bovis CQ-W70 |
| 19 | 375161 | 375400 | + | NC_014921.1 | Mycoplasmopsis fermentans M64 |
| 20 | 691700 | 691915 | + | NZ_CP008748.1 | Mycoplasma hyosynoviae |
| 21 | 521685 | 521897 | - | NZ_AP018940.1 | Mycoplasmopsis californica |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_LR215039.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00163.21 | 0.86 | 18 | 125.0 | same-strand | Ribosomal protein S4/S9 N-terminal domain |
| 2 | PF01479.27 | 0.86 | 18 | 125 | same-strand | S4 domain |
++ More..