Protein Information |
Information Type | Description |
---|---|
Protein name | 50S ribosomal protein L31 |
NCBI Accession ID | AL445563.1 |
Organism | Mycoplasma pulmonis (strain UAB CTIP) |
Left | 148881 |
Right | 149090 |
Strand | + |
Nucleotide Sequence | ATGCAAAAGGACATTCATTTAAAAATGGAACCACTGAAGATTACATGTTCAACATGTTTTACTTCATTTGACATTGTTTCGTCAAGAAAAACAATAGCTATTGACATTTGTTCAAAATGTCACCCATTCTATACAGGAGATAGAACATTGGCTAAAGCAACTGGTCAAATCGATAAGTTCCAAAAAAGATTGCAAAAAAAGCAAAAATAA |
Sequence | MQKDIHLKMEPLKITCSTCFTSFDIVSSRKTIAIDICSKCHPFYTGDRTLAKATGQIDKFQKRLQKKQK |
Source of smORF | Swiss-Prot |
Function | Binds the 23S rRNA. {ECO:0000255|HAMAP-Rule:MF_00501}. |
Pubmed ID | 11353084 |
Domain | CDD:412343 |
Functional Category | Ribosomal_protein |
Uniprot ID | Q98R70 |
ORF Length (Amino Acid) | 69 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 148881 | 149090 | + | NC_002771.1 | Mycoplasmopsis pulmonis UAB CTIP |
2 | 184377 | 184586 | + | NZ_LR215039.1 | Mycoplasmopsis columboralis |
3 | 723087 | 723296 | - | NZ_CP030141.1 | Mycoplasmopsis anatis |
4 | 101600 | 101809 | - | NZ_LR215036.1 | Mycoplasmopsis citelli |
5 | 71685 | 71894 | - | NZ_CP011368.1 | Mycoplasmopsis canis |
6 | 581137 | 581346 | - | NZ_LR214986.1 | Mycoplasmopsis cynos |
7 | 792493 | 792702 | - | NZ_CP041664.1 | Mycoplasma anserisalpingitidis |
8 | 330652 | 330861 | + | NZ_LR215024.1 | Mycoplasmopsis glycophila |
9 | 238178 | 238387 | + | NZ_LS991951.1 | Mycoplasmopsis edwardii |
10 | 798434 | 798646 | + | NZ_CP034841.1 | Mycoplasmopsis phocirhinis |
11 | 292413 | 292622 | - | NZ_LR214950.1 | Mycoplasmopsis gallinacea |
12 | 565996 | 566205 | + | NZ_AP022325.1 | Mycoplasmopsis felis |
13 | 290269 | 290481 | - | NZ_LR215037.1 | Mycoplasmopsis maculosa |
14 | 737646 | 737855 | + | NZ_LR214951.1 | Mycoplasma neurolyticum |
15 | 840502 | 840711 | + | NZ_LR214972.1 | Mycoplasmopsis bovirhinis |
16 | 12086 | 12295 | - | NZ_LR215032.1 | Mycoplasmopsis gallopavonis |
17 | 643048 | 643260 | - | NC_009497.1 | Mycoplasmopsis agalactiae PG2 |
18 | 709375 | 709587 | - | NZ_CP005933.1 | Mycoplasmopsis bovis CQ-W70 |
19 | 375161 | 375400 | + | NC_014921.1 | Mycoplasmopsis fermentans M64 |
20 | 691700 | 691915 | + | NZ_CP008748.1 | Mycoplasma hyosynoviae |
21 | 521685 | 521897 | - | NZ_AP018940.1 | Mycoplasmopsis californica |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF00163.21 | 0.86 | 18 | 125.0 | same-strand | Ribosomal protein S4/S9 N-terminal domain |
2 | PF01479.27 | 0.86 | 18 | 125 | same-strand | S4 domain |