Protein Information |
Information Type | Description |
---|---|
Protein name | Acyl carrier protein homolog (ACP) |
NCBI Accession ID | AL445564.1 |
Organism | Mycoplasma pulmonis (strain UAB CTIP) |
Left | 92358 |
Right | 92579 |
Strand | + |
Nucleotide Sequence | ATGGCCATCAAAGAATGAATAATTACACAACTTTCAAAACTAACTAAAAACAAAATTACTGAAGAGAGTTTATTTTCAGAAATCGGAATTGACTCACTTGATTTGGTAGAACATGTCTCTGATTTAGAGCAACACTTTGACATTGAAATTAGTGATGAAGAGCTTTTAAATATTAAAAAAGTTAACGATATTATTGTTTTAATTGAACAAAAAAGTAAATAA |
Sequence | MAIKEWIITQLSKLTKNKITEESLFSEIGIDSLDLVEHVSDLEQHFDIEISDEELLNIKKVNDIIVLIEQKSK |
Source of smORF | Swiss-Prot |
Function | Carrier of the growing fatty acid chain in fatty acid biosynthesis. {ECO:0000250}. |
Pubmed ID | 11353084 |
Domain | CDD:415812 |
Functional Category | Others |
Uniprot ID | Q98QK3 |
ORF Length (Amino Acid) | 73 |
Conservation Analysis |
Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
---|---|---|---|---|---|
1 | 199802 | 200026 | + | NZ_CP055143.1 | Mycoplasma hominis |
2 | 1003265 | 1003498 | + | NC_014921.1 | Mycoplasmopsis fermentans M64 |
Neighborhood Conservation Analysis |
Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
---|---|---|---|---|---|---|
1 | PF03462.20 | 1.0 | 2 | 568.0 | same-strand | PCRF domain |
2 | PF00472.22 | 1.0 | 2 | 568.0 | same-strand | RF-1 domain |