Result : Q98PZ0
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | 50S ribosomal protein L29 |
| NCBI Accession ID | AL445565.1 |
| Organism | Mycoplasma pulmonis (strain UAB CTIP) |
| Left | 53827 |
| Right | 54024 |
| Strand | - |
| Nucleotide Sequence | ATGAAATTTAAAGATATAAATGTTAAACCAGTTGCTGAATTAGAACAAATGGTAAATGATCTAAAAGCTGAATTATTTACTTTAAGATTTCAAAACTCAACAGGACAATTAGATCAAACACACAAAATTAAAATGGTAAGACAAGACATTGCTAAAGTCTTAACAGCACTAAGTCAAAAAAATAGAGGAGCACAATAA |
| Sequence | MKFKDINVKPVAELEQMVNDLKAELFTLRFQNSTGQLDQTHKIKMVRQDIAKVLTALSQKNRGAQ |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl09943. Profile Description: N/A. This family represents the N-terminal region (approximately 8 residues) of the eukaryotic mitochondrial 39-S ribosomal protein L47 (MRP-L47). Mitochondrial ribosomal proteins (MRPs) are the counterparts of the cytoplasmic ribosomal proteins, in that they fulfil similar functions in protein biosynthesis. However, they are distinct in number, features and primary structure. |
| Pubmed ID | 11353084 |
| Domain | CDD:415815 |
| Functional Category | Ribosomal_protein |
| Uniprot ID | Q98PZ0 |
| ORF Length (Amino Acid) | 65 |
++ More..
| Conservation Analysis |
No. of Species: 101
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 702627 | 702824 | - | NC_002771.1 | Mycoplasmopsis pulmonis UAB CTIP |
| 2 | 249117 | 249311 | + | NZ_AP018940.1 | Mycoplasmopsis californica |
| 3 | 573887 | 574081 | - | NZ_LR214970.1 | Mycoplasmopsis bovigenitalium |
| 4 | 818194 | 818388 | + | NZ_CP034841.1 | Mycoplasmopsis phocirhinis |
| 5 | 246997 | 247191 | + | NZ_LR215031.1 | Mycoplasmopsis gallopavonis |
| 6 | 249316 | 249510 | + | NZ_LR215024.1 | Mycoplasmopsis glycophila |
| 7 | 579762 | 579956 | - | NZ_AP022325.1 | Mycoplasmopsis felis |
| 8 | 181716 | 181916 | + | NZ_CP029295.1 | Mycoplasma phocidae |
| 9 | 705107 | 705310 | - | NC_014921.1 | Mycoplasmopsis fermentans M64 |
| 10 | 519080 | 519280 | + | NZ_CP033058.2 | Mycoplasma phocicerebrale |
| 11 | 315639 | 315842 | + | NZ_CP030103.1 | Mycoplasma cloacale |
| 12 | 486335 | 486538 | + | NZ_CP034044.1 | Mycoplasma struthionis |
| 13 | 559561 | 559752 | - | NZ_CP040825.1 | Mycoplasma nasistruthionis |
| 14 | 423763 | 423966 | - | NZ_CP007154.1 | Mycoplasma bovoculi M165/69 |
| 15 | 593698 | 593898 | + | NZ_AP014631.1 | Mycoplasma canadense |
| 16 | 366761 | 366961 | - | NZ_CP055143.1 | Mycoplasma hominis |
| 17 | 152499 | 152699 | - | NZ_AP014657.1 | Mycoplasmopsis arginini |
| 18 | 862280 | 862486 | + | NZ_LR214951.1 | Mycoplasma neurolyticum |
| 19 | 144627 | 144821 | + | NZ_LS991951.1 | Mycoplasmopsis edwardii |
| 20 | 281025 | 281219 | - | NZ_LR214972.1 | Mycoplasmopsis bovirhinis |
| 21 | 4366290 | 4366487 | - | NZ_CP022657.1 | Tumebacillus algifaecis |
| 22 | 1791557 | 1791754 | + | NZ_CP021434.1 | Tumebacillus avium |
| 23 | 181005 | 181205 | + | NZ_LS991949.1 | Mycoplasma alkalescens |
| 24 | 339494 | 339694 | + | NC_012778.1 | [Eubacterium] eligens ATCC 27750 |
| 25 | 285367 | 285564 | - | NZ_CP026363.1 | Brevibacillus agri |
| 26 | 1370395 | 1370595 | - | NZ_CP018622.1 | Virgibacillus dokdonensis |
| 27 | 271422 | 271619 | + | NZ_LR134338.1 | Brevibacillus brevis |
| 28 | 3950415 | 3950618 | - | NZ_CP019870.1 | Clostridioides difficile |
| 29 | 3824373 | 3824564 | - | NZ_CP012621.1 | Zobellella denitrificans |
| 30 | 2042519 | 2042710 | + | NZ_CP021377.1 | Oceanisphaera profunda |
| 31 | 2326349 | 2326546 | + | NZ_CP017705.1 | Brevibacillus laterosporus DSM 25 |
| 32 | 205832 | 206023 | - | NZ_CP009610.1 | Haemophilus influenzae |
| 33 | 301461 | 301652 | - | NZ_LS483458.1 | Haemophilus haemolyticus |
| 34 | 216126 | 216317 | - | NZ_LS483429.1 | Haemophilus aegyptius |
| 35 | 2473473 | 2473664 | + | NZ_CP021376.1 | Oceanisphaera avium |
| 36 | 410243 | 410434 | - | NZ_LT906463.1 | Haemophilus pittmaniae |
| 37 | 270171 | 270362 | + | NZ_CP071325.1 | Photobacterium ganghwense |
| 38 | 640993 | 641190 | + | NZ_AP018724.1 | Sulfurivermis fontis |
| 39 | 233623 | 233814 | + | NZ_CP061941.1 | Marinomonas algicola |
| 40 | 1335526 | 1335729 | + | NZ_CP016312.1 | Thermus brockianus |
| 41 | 127507 | 127698 | + | NC_012691.1 | Tolumonas auensis DSM 9187 |
| 42 | 983793 | 983984 | - | NZ_CP048812.1 | Halomonas socia |
| 43 | 132279 | 132452 | + | NZ_CP019699.1 | Novibacillus thermophilus |
| 44 | 746734 | 746928 | - | NZ_CP011368.1 | Mycoplasmopsis canis |
| 45 | 598823 | 599029 | + | NZ_CP014864.1 | Microbulbifer thermotolerans |
| 46 | 2620016 | 2620207 | - | NZ_CP009977.1 | Vibrio natriegens NBRC 15636 = ATCC 14048 = DSM 759 |
| 47 | 124994 | 125185 | - | NC_013456.1 | Vibrio antiquarius |
| 48 | 2996135 | 2996326 | - | NZ_CP031781.1 | Vibrio parahaemolyticus |
| 49 | 4254429 | 4254629 | - | NZ_CP020330.1 | Martelella mediterranea DSM 17316 |
| 50 | 132456 | 132647 | + | NZ_CP014226.1 | Halomonas chromatireducens |
| 51 | 1775646 | 1775837 | - | NZ_CP013988.1 | Aerococcus urinaeequi |
| 52 | 427616 | 427807 | + | NZ_CP014164.1 | Aerococcus viridans |
| 53 | 3589017 | 3589208 | - | NZ_CP040449.1 | Aeromonas simiae |
| 54 | 1774564 | 1774755 | - | NZ_CP070273.1 | Marinomonas foliarum |
| 55 | 2307591 | 2307767 | + | NZ_CP033719.1 | Propionibacterium acidifaciens |
| 56 | 4307903 | 4308094 | - | NZ_CP061081.1 | Marinomonas arctica |
| 57 | 1318653 | 1318859 | - | NZ_LT635480.1 | Ndongobacter massiliensis |
| 58 | 1577209 | 1577400 | + | NZ_CP014143.1 | Microbulbifer aggregans |
| 59 | 1586378 | 1586542 | - | NC_006461.1 | Thermus thermophilus HB8 |
| 60 | 413719 | 413883 | + | NZ_CP014141.1 | Thermus parvatiensis |
| 61 | 814928 | 815125 | - | NZ_CP014163.1 | Aerococcus urinaehominis |
| 62 | 3631379 | 3631576 | - | NZ_CP033433.1 | Cohnella candidum |
| 63 | 2171430 | 2171621 | + | NZ_CP046793.1 | Vibrio metschnikovii |
| 64 | 4060277 | 4060465 | - | NC_014376.1 | [Clostridium] saccharolyticum WM1 |
| 65 | 2702241 | 2702432 | - | NZ_CP016414.1 | Vibrio scophthalmi |
| 66 | 805692 | 805898 | - | NZ_LT635475.1 | Ezakiella massiliensis |
| 67 | 5172657 | 5172848 | - | NZ_CP020038.1 | Agarilytica rhodophyticola |
| 68 | 1823437 | 1823628 | + | NZ_CP040863.1 | Rodentibacter heylii |
| 69 | 108396 | 108572 | - | NZ_CP048630.1 | Ancylobacter pratisalsi |
| 70 | 3725089 | 3725289 | + | NZ_CP035492.1 | Paenibacillus protaetiae |
| 71 | 1226777 | 1226983 | - | NZ_LR134523.1 | Peptoniphilus ivorii |
| 72 | 2716930 | 2717121 | - | NZ_AP019651.1 | Vibrio taketomensis |
| 73 | 2853393 | 2853584 | - | NZ_CP032093.1 | Vibrio alfacsensis |
| 74 | 3184255 | 3184446 | + | NZ_AP019657.1 | Vibrio ponticus |
| 75 | 408956 | 409147 | + | NZ_CP044069.1 | Vibrio vulnificus |
| 76 | 280258 | 280449 | + | NZ_CP030788.1 | Vibrio campbellii |
| 77 | 255227 | 255418 | + | NZ_CP009354.1 | Vibrio tubiashii ATCC 19109 |
| 78 | 2822526 | 2822717 | - | NZ_CP018312.1 | Vibrio rotiferianus |
| 79 | 1543835 | 1544026 | - | NZ_CP019959.1 | Vibrio owensii |
| 80 | 487958 | 488149 | + | NZ_CP009467.1 | Vibrio harveyi |
| 81 | 1956313 | 1956504 | - | NZ_CP025792.1 | Vibrio jasicida 090810c |
| 82 | 2278126 | 2278317 | - | NZ_CP035688.1 | Vibrio metoecus |
| 83 | 2620372 | 2620563 | - | NZ_AP014524.1 | Vibrio cholerae MS6 |
| 84 | 3096292 | 3096483 | + | NZ_CP014035.2 | Vibrio fluvialis |
| 85 | 313416 | 313607 | + | NC_014541.1 | Ferrimonas balearica DSM 9799 |
| 86 | 2719273 | 2719464 | - | NZ_CP029347.1 | Saliniradius amylolyticus |
| 87 | 3776328 | 3776519 | + | NZ_CP051180.1 | Ferrimonas lipolytica |
| 88 | 282760 | 282951 | + | NZ_AP018689.1 | Vibrio aphrogenes |
| 89 | 317638 | 317829 | + | NZ_AP018685.1 | Vibrio rumoiensis |
| 90 | 1787332 | 1787523 | + | NZ_CP065150.1 | Vibrio kanaloae |
| 91 | 2975575 | 2975766 | - | NC_011753.2 | Vibrio atlanticus |
| 92 | 312625 | 312816 | + | NZ_CP039700.1 | Vibrio cyclitrophicus |
| 93 | 237269 | 237460 | + | NZ_CP028897.1 | Dongshaea marina |
| 94 | 3112398 | 3112589 | - | NZ_AP014635.1 | Vibrio tritonius |
| 95 | 2545787 | 2545978 | - | NZ_CP033078.1 | Vibrio zhugei |
| 96 | 121350 | 121541 | - | NZ_CP040990.1 | Vibrio furnissii |
| 97 | 2851611 | 2851802 | - | NZ_CP045350.1 | Vibrio aquimaris |
| 98 | 209708 | 209899 | + | NZ_AP022843.1 | Halomonas hydrothermalis |
| 99 | 483975 | 484166 | + | NC_007963.1 | Chromohalobacter salexigens DSM 3043 |
| 100 | 2217767 | 2217958 | + | NZ_CP072133.1 | Pseudoalteromonas xiamenensis |
| 101 | 368050 | 368241 | + | NC_011312.1 | Aliivibrio salmonicida LFI1238 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NZ_CP022657.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF00281.21 | 0.96 | 97 | 1105 | same-strand | Ribosomal protein L5 |
| 2 | PF17136.6 | 0.9 | 91 | 770 | same-strand | Ribosomal proteins 50S L24/mitochondrial 39S L24 |
| 3 | PF00467.31 | 0.86 | 87 | 752 | same-strand | KOW motif |
| 4 | PF00238.21 | 0.95 | 96 | 338.0 | same-strand | Ribosomal protein L14p/L23e |
| 5 | PF00366.22 | 1.0 | 101 | 0 | same-strand | Ribosomal protein S17 |
| 6 | PF00189.22 | 0.95 | 96 | 426.0 | same-strand | Ribosomal protein S3, C-terminal domain |
| 7 | PF00237.21 | 0.98 | 99 | 1139 | same-strand | Ribosomal protein L22p/L17e |
| 8 | PF00203.23 | 0.78 | 79 | 1483 | same-strand | Ribosomal protein S19 |
| 9 | PF07650.19 | 0.82 | 83 | 425 | same-strand | KH domain |
| 10 | PF00253.23 | 0.72 | 73 | 1677 | same-strand | Ribosomal protein S14p/S29e |
| 11 | PF03947.20 | 0.79 | 80 | 1785.0 | same-strand | Ribosomal Proteins L2, C-terminal domain |
| 12 | PF00181.25 | 0.79 | 80 | 1785.0 | same-strand | Ribosomal Proteins L2, RNA binding domain |
| 13 | PF00673.23 | 0.74 | 75 | 1131 | same-strand | ribosomal L5P family C-terminus |
| 14 | PF00252.20 | 0.78 | 79 | 0 | same-strand | Ribosomal protein L16p/L10e |
++ More..