Result : Q98ND4
| Protein Information |
| Information Type | Description |
|---|---|
| Protein name | UPF0386 protein mll0189 |
| NCBI Accession ID | BA000012.4 |
| Organism | Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) (Mesorhizobium loti (strain MAFF 303099)) |
| Left | 129888 |
| Right | 130187 |
| Strand | - |
| Nucleotide Sequence | GTGCCACATTATAATTGCCACAGCGTCCTTTGCGCGTCCAAGAGGACGCGCGGCGCTGTGGGACAACGCATCCTGCACATGCTTGCGCAGGGCGGACGCATTGAAATCGAAAAGAACCAGAAGAAACGGATCGCCTCCGTCAAATGCCTGACCCGCGATGGCTGGCACCATCCGGGCGTCGATCTCGACCTGTTTCGAAAGCTGAAACGCAAGAAGGCGGTTTCGTCGTCGGGCGGCGGTCCCTATCGCATCACCCGGCGCGGCCTCGAACTCGTCCGCTCCGAACTCGACAACCGATAG |
| Sequence | MPHYNCHSVLCASKRTRGAVGQRILHMLAQGGRIEIEKNQKKRIASVKCLTRDGWHHPGVDLDLFRKLKRKKAVSSSGGGPYRITRRGLELVRSELDNR |
| Source of smORF | Swiss-Prot |
| Function | The ORF matches to the profile of cl01566. Profile Description: Putative toxin of bacterial toxin-antitoxin pair. hypothetical protein; Provisional |
| Pubmed ID | 11214968 |
| Domain | CDD:412966 |
| Functional Category | Others |
| Uniprot ID | Q98ND4 |
| ORF Length (Amino Acid) | 99 |
++ More..
| Conservation Analysis |
No. of Species: 4
| Sr.No. | Left Position | Right Position | Strand | NCBI Accession id | Species Name |
|---|---|---|---|---|---|
| 1 | 129888 | 130187 | - | NC_002678.2 | Mesorhizobium japonicum MAFF 303099 |
| 2 | 4300044 | 4300301 | + | NZ_CP015318.1 | Mesorhizobium amorphae CCNWGS0123 |
| 3 | 3379088 | 3379390 | + | NZ_CP015064.1 | Mesorhizobium ciceri biovar biserrulae |
| 4 | 4383549 | 4383806 | + | NC_019973.1 | Mesorhizobium australicum WSM2073 |
++ More..
| Neighborhood Conservation Analysis |
* Arrows marked in Genome Diagram shows ORFs; Multiple PFAMs can be mapped to a single ORF.
* 'Small ORF' represents the entry/query analyzed.
* Image generated using 'gggenes'(R-Package).
Neighborhood Representative Chosen(Species): NC_019973.1
| Sr.No. | Domain | Co-occurrence Frequency | No. of species in which domain occurs with smORF | Median distance b/w smORF and domain bearing ORFs | Orientation relative to smORF | PFAM Information |
|---|---|---|---|---|---|---|
| 1 | PF06035.13 | 0.75 | 3 | 3403 | same-strand | Bacterial transglutaminase-like cysteine proteinase BTLCP |
| 2 | PF07238.16 | 0.75 | 3 | 2501 | same-strand | PilZ domain |
| 3 | PF07310.15 | 0.75 | 3 | 1732 | same-strand | PAS domain |
| 4 | PF01694.24 | 1.0 | 4 | 567.5 | opposite-strand | Rhomboid family |
| 5 | PF00571.30 | 1.0 | 4 | 48.5 | opposite-strand | CBS domain |
| 6 | PF02934.17 | 1.0 | 4 | 318.5 | opposite-strand | GatB/GatE catalytic domain |
| 7 | PF02637.20 | 1.0 | 4 | 318.5 | opposite-strand | GatB domain |
| 8 | PF00583.27 | 1.0 | 4 | 1822.5 | opposite-strand | Acetyltransferase (GNAT) family |
| 9 | PF13508.9 | 1.0 | 4 | 1822.5 | opposite-strand | Acetyltransferase (GNAT) domain |
| 10 | PF13420.9 | 0.75 | 3 | 1790 | opposite-strand | Acetyltransferase (GNAT) domain |
| 11 | PF01987.19 | 0.75 | 3 | 2504 | opposite-strand | Mitochondrial biogenesis AIM24 |
| 12 | PF02569.17 | 0.75 | 3 | 3252 | same-strand | Pantoate-beta-alanine ligase |
| 13 | PF02548.17 | 0.75 | 3 | 4100 | same-strand | Ketopantoate hydroxymethyltransferase |
| 14 | PF13673.9 | 0.75 | 3 | 1790 | opposite-strand | Acetyltransferase (GNAT) domain |
++ More..